SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010187 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010187
Domain Number 1 Region: 214-406
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.48e-53
Family Mitochondrial carrier 0.00034
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily EF-hand 3.71e-17
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010187   Gene: ENSSARG00000011276   Transcript: ENSSART00000011289
Sequence length 416
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_818:64178:103894:-1 gene:ENSSARG00000011276 transcript:ENSSART00000011289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLFNSGDINKDGKLSFEEFVKYLKDHEIKMKLAFNTLDKNNDGKIDASEIVQSLQILGLT
ISEEQAKLILRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKKLLTEEGQKIGTFERFVSGSMAGAT
AQTFIYPLEVMKTRLAVSKTGQYSGIFDCAKKTLKREGIGAFYKGYIPNLLGIIPYAGID
LTVYELLKTHWLDNFAKDSVNPGVVVLLGCGALSSTCGQLASYPLSLVRTRMQAQAMVEG
APQLNMVGLFRRIVSKEGVAGLYRGIAPNFMKVLPAVGISYVVYENMKQTLGVTQK
Download sequence
Identical sequences ENSSARP00000010187 ENSSARP00000010187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]