SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010673 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010673
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.12e-68
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000854
Further Details:      
 
Domain Number 2 Region: 214-306
Classification Level Classification E-value
Superfamily E set domains 1.76e-27
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010673   Gene: ENSSARG00000011809   Transcript: ENSSART00000011818
Sequence length 584
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4843:2834:78651:1 gene:ENSSARG00000011809 transcript:ENSSART00000011818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGYNPYIEIIEQPRQRGLRFRYECEGRSAGSIPGEHSTENNRTYPSIQIANYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQILGIRCVKKKEVKEAII
SRIKAGINPFNVPEPQLLDIEDCDLKVVRLCFQVFLPDERGNLTTALPPIVSNPIYDNXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIEVRFVLNNWEAKGIFSQADVHRQV
AIVFKTPPYCKPIMEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKAKKQKTTLLF
QKMWQDCANFPERPQLCPPGSSGEGKLIKKESNLFSSAPGLREIPRPSEISSQSESYYSS
PVSISGVSSVVPQPPSSWSSAAHPTAHLGNTNPPSSFSAGTHCSNSSSISSYLENPVRRD
LPTTNACIFNNIDDMSRMESPSISTADLYGIPNASMLSNCPVNMMPPSNDIMRETDNSRL
LSLNLENPPCNSVLDPRDFRQLHQMSSSSTSAGTSSSTTAFASQSAAFEGSDFSCTNNSM
LNESGPSNITNASNHSFVQNSQYGDIGSLQNEQLSDSFAFGFFQ
Download sequence
Identical sequences ENSSARP00000010673 ENSSARP00000010673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]