SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010960 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010960
Domain Number 1 Region: 164-297
Classification Level Classification E-value
Superfamily E set domains 1.21e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000265
Further Details:      
 
Domain Number 2 Region: 83-169
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.4e-23
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010960   Gene: ENSSARG00000012146   Transcript: ENSSART00000012140
Sequence length 423
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_1394:693:11561:1 gene:ENSSARG00000012146 transcript:ENSSART00000012140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIDEFIKEEGFGVDGSLLGPGGEGWPLLVPRGXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLK
NHQEVDMNVVRICFLASYRDPQGQLRRLDPVLSEPVYDKKSTNTSELRICRINKESGPCT
GGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVLKTPPYEDLEIAEPVT
VNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDRKRKRGMPDLMGELNSSDPHGIESKRRR
KKPAFLDHFLPSHSSGQFLPPAAKAKDDFFPGTVTRVEPPGGPDLLEDGFTVDPSAPTIF
NMRDMQSPPPPLPSXEPLTLDSYQVPGPGDGGTASLVGSNMFPNQYRETGFGGGLLSPGP
EAT
Download sequence
Identical sequences ENSSARP00000010960 ENSSARP00000010960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]