SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000011204 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000011204
Domain Number 1 Region: 264-533
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-71
Family Protein kinases, catalytic subunit 0.000000000913
Further Details:      
 
Domain Number 2 Region: 151-295
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-40
Family SH2 domain 0.00000641
Further Details:      
 
Domain Number 3 Region: 83-202
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-26
Family SH3-domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000011204   Gene: ENSSARG00000012410   Transcript: ENSSART00000012405
Sequence length 541
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_700:125758:164740:-1 gene:ENSSARG00000012410 transcript:ENSSART00000012405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKENKSPSIKYRTENTPEPVSPSINQYGAEHTAVTPSSSVKGTSVNFSSISMSPF
GGSSGMTPFGGASSSFSVVPSSYPTGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIIN
NTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAFSLSIRDWDEVKGDNVKHYKIRKLDNGGYYITTRAQFETLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGILLDFLKE
GDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIE
DNEYTARQXXXXXXXXXXXXXXXXGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN
L
Download sequence
Identical sequences ENSSARP00000011204 ENSSARP00000011204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]