SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000012279 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000012279
Domain Number 1 Region: 179-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.64e-39
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.12e-31
Family Tetramerization domain of potassium channels 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000012279   Gene: ENSSARG00000013606   Transcript: ENSSART00000013602
Sequence length 655
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_422:60463:113130:-1 gene:ENSSARG00000013606 transcript:ENSSART00000013602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENHQEALPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGSVPGRKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTDNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKARLARIRVAKTGSSNAYLHSKRNGLLNEALELMGTLEEEQVGKTTSLIESQHHHLL
HCLEKTTGLSYLVDEPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHQ
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHVQGSEQPSLTTSRSSLNLKADEG
LRPNCKTSQITTAIISIPTPPVLTPEGESRPPPASAGPNTNIPSVASNVVKVSAL
Download sequence
Identical sequences ENSSARP00000012279 ENSSARP00000012279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]