SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000012379 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000012379
Domain Number 1 Region: 521-971
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.34e-129
Family PIWI domain 0.02
Further Details:      
 
Domain Number 2 Region: 231-457
Classification Level Classification E-value
Superfamily PAZ domain 1.02e-52
Family PAZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000012379   Gene: ENSSARG00000013686   Transcript: ENSSART00000013710
Sequence length 971
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_6794:12692:100155:1 gene:ENSSARG00000013686 transcript:ENSSART00000013710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVRPPFRGPTPLRPSQCVRMPCPWPQSPKSLDSAVGRAGPIGRGHVFGKPRESSPQSG
PANKEPVGLVSMFRGLGLEAASHIPLKKEMPHLGRGILGRGLPTTVVHKDKEEPYSPGFP
DSSVLAAGDSKMAEASIGWTRVLGRGNSDGSLLSLGRAAGGIGRGVYKAPKALGLTSQDP
TQLSSPPPPLPQSSLHSVDRSLELTVEHKEKEIFVKQGSKGTPQSLGLNLIKIQCHNEAV
YQYHVTFSPSVECKSMRFGMLRDHQAVTGNVTAFDGSILYLPVKLQQILELKSQRKTDGA
EISIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIW
PGYAASIRRTDGGLFLLADVSHKVIRNDSVLDVMHAMYQQNKESFQDECTKLLVGNIVIT
RYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLAQQINLSPRQHHSALECLLQRIS
KNEMATNELTRWGLCLQKDVHKIEGRVLPMERINLRNTSFITSQELNWVKEVTRELSILT
VPMHFWALFYPKKAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYIRTIQSML
GVEGKIQMVVCIIMGTRDDLYGAIKKLCCVQTPVPSQVINVRTISQPARLRSVAQKILLQ
INCKLCELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPH
QEIVDSLKLCLVGSLKKFYVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFEN
YQPKMVVFVVQKKISTNLYLAAAEHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGI
PTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEP
AIQLCENLFFL
Download sequence
Identical sequences ENSSARP00000012379 ENSSARP00000012379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]