SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21229627|ref|NP_635544.1| from Xanthomonas campestris pv. campestris str. ATCC 33913

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21229627|ref|NP_635544.1|
Domain Number 1 Region: 46-325
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.8e-77
Family alpha-L-arabinanase-like 0.0000111
Further Details:      
 
Domain Number 2 Region: 343-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-24
Family Beta-D-xylosidase C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21229627|ref|NP_635544.1|
Sequence length 526
Comment xylosidase/arabinosidase [Xanthomonas campestris pv. campestris str. ATCC 33913]
Sequence
MRFRTTPLALRWLTTGLLLCASLATAADWKRGIEHQRIADQGNGTFLNPVLAGDHPDPSV
LKDGQDYYLTLSSFDAYPGLPIWHSRDLVNWQPLGHAITQNVGAIWAPDLIKHGKRYYIY
FPARRGDQGERSNFVVWADDIKGPWSKPIDIGLGKYIDPGHAVGEDGKRYLFLSGGDYVQ
LSDDGLKVVGTPKHVYDGWKYPESWDVEGYAQEGPKITRHNGWYYMTTAVGGTAGPPTGH
MVITARSRSIHGPWQNAPNNPITRTKSADEPWWSRGHATLVEGTDQRWWMLYHGYEHGFW
TLGRQALLDPIEWTPDGWFVAKGGDLGTPLKKPSGQALPHGLALSDDFRAATLGPQWSFF
NPAADEAKRLQVGDGVLRLQGKGSAPRDASPLTVIATDQAYQFEVQMTVAPGGQGGALLF
YSDKLYAGVGSNGEHFVMHRYGEERPAKLAPSSKGGALWLRVTNNRHIVTIHTSTDGTTW
TKYPVQMEVSGYHHNVAGKFLALKPALYAAGQGQVEFRNFRYRALD
Download sequence
Identical sequences A0A0H2X2Y0 B0RLC8 Q8PE34
gi|188989562|ref|YP_001901572.1| gi|21229627|ref|NP_635544.1| gi|66766503|ref|YP_241265.1| NP_635544.1.47755 WP_011035406.1.10627 WP_011035406.1.12496 WP_011035406.1.16446 WP_011035406.1.1732 WP_011035406.1.18295 WP_011035406.1.22538 WP_011035406.1.27778 WP_011035406.1.31612 WP_011035406.1.36111 WP_011035406.1.40219 WP_011035406.1.43481 WP_011035406.1.4502 WP_011035406.1.56666 WP_011035406.1.82601 WP_011035406.1.88278 190485.XCC0149 314565.XC_0158 509169.xccb100_0166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]