SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77747979|ref|NP_639444.2| from Xanthomonas campestris pv. campestris str. ATCC 33913

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77747979|ref|NP_639444.2|
Domain Number 1 Region: 52-360
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.57e-84
Family alpha-L-arabinanase-like 0.00000318
Further Details:      
 
Domain Number 2 Region: 375-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-43
Family Beta-D-xylosidase C-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77747979|ref|NP_639444.2|
Sequence length 565
Comment xylosidase/arabinosidase [Xanthomonas campestris pv. campestris str. ATCC 33913]
Sequence
MRALLLAVSVALVAPLAAYAQPAAPKQAVAFDWFEYRGDDPVFATPLPAGHYRNPILAGF
YPDPSITRVGERYYLVNSTFAYFPAIPVFESTDLVHWTQVGNVVERREQLDYDGLGVSRG
MFAASIRHHAGRFYVVGTAVDSGGNFIASATSAAGPWSTLSWLPGVDGIDPSLFFDTDGS
AYLLNNGPPEGTPLYEGHRAIWMQRFDLATHQPVGLRKVLLNGGVDLASKPIWIEGPHLY
QRDGWYYLSCAEGGTGPQHSQVVLRSRNVWGPYAPAPHNPILTQRDLPAGRAQPISNAGH
VDLVDTPDGQWWAVFLASRPYAHDRYNTGRETFLLPVQWRDGWPSILPPGAPIPYVAKAP
HGTPARIDQTPLSGNFTWRDGFDAPTPQREWLSLRVPKRDWADLRARPGWLTLHATPQGL
ASTGNPAFLGRRQQHTHFTASTALELPAHAGISAGLAAVQNSNAWYALGVRRDGDGAEVF
VDKRDGTRTTTLARARIPVTTAPLRLQISGDGGRYSFAFDATGHGWQWLQRHDDASMLST
AQAGGFVGSTIGPFAQLDPDRTKED
Download sequence
Identical sequences NP_639444.2.47755 WP_011039174.1.27778 WP_011039174.1.43481 gi|77747979|ref|NP_639444.2| 190485.XCC4105 314565.XC_4196 gi|77761333|ref|YP_245254.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]