SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383455175|ref|YP_005369164.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383455175|ref|YP_005369164.1|
Domain Number 1 Region: 380-453
Classification Level Classification E-value
Superfamily LCCL domain 5.49e-20
Family LCCL domain 0.00095
Further Details:      
 
Domain Number 2 Region: 280-354
Classification Level Classification E-value
Superfamily LCCL domain 1.11e-19
Family LCCL domain 0.00077
Further Details:      
 
Domain Number 3 Region: 97-195,228-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.81e-16
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383455175|ref|YP_005369164.1|
Sequence length 455
Comment hypothetical protein COCOR_03188 [Corallococcus coralloides DSM 2259]
Sequence
MRRLSMALLVGVSIAGCGGDPEVENREIISNLIEAGFPANDIQVFDGNVYVGRDAHVTLE
ASRELLQPLEEGSAEQYRTTNQVGTSVTKICVNPTAAFNSYSNLSQGLDLAIANYNEQGL
RLTFARGPTTGCTANISAETTTGTGGQAGFPSNGMPYGVFYIGTGLDSYSADVNEHVITH
ELGHAIGFRHSDYYNRSISCGIGGDEGEAGVGAIHIPNTPTTATVGGSVMNSCFRSTETG
EWTGSDITALAALYSTGGGVQSCSNYNIISYRGQNGTQIRCGCDAVGGGTVWGTDLYTDD
SSVCVAAVHAGAIGTAGGTVVVTIQPGQSSYAGTTRNGVTTYSYGAWAGSFSVSGTTPPL
NSCSSYSFTSYRGQNGTSIRCSCGPVSGGTVWGTDLYTDDSNACAAAVHAGVIPASGGNV
SVTIQPGQSSYTGTTRNGITTYSYGAWAGSFSLSP
Download sequence
Identical sequences H8MF84
WP_014396004.1.7229 gi|383455175|ref|YP_005369164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]