SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383452545|ref|YP_005366534.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383452545|ref|YP_005366534.1|
Domain Number 1 Region: 527-688
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-41
Family Histidine kinase 0.0024
Further Details:      
 
Domain Number 2 Region: 323-445
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.99e-18
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 3 Region: 170-316
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-18
Family GAF domain 0.004
Further Details:      
 
Domain Number 4 Region: 38-144
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000718
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.072
Further Details:      
 
Domain Number 5 Region: 458-537
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000569
Family Homodimeric domain of signal transducing histidine kinase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383452545|ref|YP_005366534.1|
Sequence length 698
Comment sensory box histidine kinase [Corallococcus coralloides DSM 2259]
Sequence
MAQEQRETGSAAALGQSSVASDLVDTRRFQRAGSLLREALFELDAAGRLVLATPAWERLV
GAPVHAWLGRSLVELFHPEDRDQARVLLRTALARTDVPSRLELRLSGTPQPRWVELSATG
DPEHLGGVLGTLVDVTPRRLAEEAAATRERYLGAMVEVQRQLLAPEASGDVYNSILEPLG
RVAGASRAYVFEFHRDASGRMLQSQRAEWCAPGISRELDNPDTQAWPIDQAFTLSQLEQL
HRGEAVQGSPEDFGADNAPVLLAQGIRSLLVLPLVVHGEPFGFIGFDNCDDSRPWSHVEV
NLLSGAAGALSLALEQHTTDALRMRTETALRRTEAGFHLLIEGFPDPVVVHTTDGMLLSV
NPAMANYLGYQDPAQLLGRHLLGLVRREDQEVARRHLEEAQDGALAARSHEVPLVRRDGQ
VVSADLVTLGVLFDGVPARVTVARDFTERKHMQAQLMLGDRLASMGMLAAGIAHELNNPL
SYVLSNLEFLHRALGPMPRPLGAEELLEYQQVLDDAREGSERMRQIVRQLKVFSRVDDAH
EEAVDLHRVLDSVAQMAASEIRPRARLVKQYGVVPTVRANEGKLFQVFLNLVINAAHAIP
EGFTDAHEIRLITRVDDDDRVVVEVRDTGRGIAPELLRRIFDPFFTTKAPGQGTGLGLSI
CDTIVRALGGTITAESTPGNGATFRVTLHVSARPARVA
Download sequence
Identical sequences H8MEK3
gi|383452545|ref|YP_005366534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]