SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383453631|ref|YP_005367620.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383453631|ref|YP_005367620.1|
Domain Number 1 Region: 8-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-62
Family Protein kinases, catalytic subunit 0.0000486
Further Details:      
 
Domain Number 2 Region: 491-519,568-630
Classification Level Classification E-value
Superfamily TPR-like 0.000000582
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383453631|ref|YP_005367620.1|
Sequence length 646
Comment serine/threonine protein kinase [Corallococcus coralloides DSM 2259]
Sequence
MALQAGDIFGRYELVSWLGRGGMAETWRAQLVGDAGVTKPVLIKKVLPEYANDEAFISMF
ISEARISATLSHGNVAQVFDFGRVDGEYFLAMEFVDGQPLHRVLKRALKSDLGALPIPVA
VFIAMEMCRGLHYAHTRMDNSGRPLGIVHRDISPDNVLLGYEGQVKIVDFGIAKAQLIRG
FKTAPGVVKGKYLFFSPEQARGEDVDARTDVWATGVVLYELLCGKLPVEGPPHVVMMRVG
RGEIPAPSVLRPDLPKELNDIVMKALTPDREQRFESSHAFGDALAGFLYSNFPRFSSMTI
AHLLRVLFRGDLAQEGREMSVPGSFLEELKSWRQQTAPEEPVTPRPSTERQTRRVRPVSP
HVTETTQPRSIVASSGTSRPLLYGLSAGGLLVVGASLWLLLDAHSPSTAGGAPPPTPIRA
PITVEASSLPATAESPPAPRVELAQALPPPVEDAQLHAPDVPAPETREPPRISAKEAADV
KKMKVGVARAIRLKQHPDAVYLSNHCVEMYPTNADCHALVQLVGEKLFNDPPRPKTDSPT
RLTTEADIQRAMTSAASIANSITDIMAHVHMLSRAGHSDKGLEVAQNCAAKAPKLPECQL
MLGVLYVKIGDFRKSTEAYERFLTLAPPDHPRRARVVEILNQASRQ
Download sequence
Identical sequences H8MYH3
gi|383453631|ref|YP_005367620.1| WP_014394463.1.7229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]