SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383453632|ref|YP_005367621.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383453632|ref|YP_005367621.1|
Domain Number 1 Region: 8-377
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-63
Family Protein kinases, catalytic subunit 0.0000438
Further Details:      
 
Domain Number 2 Region: 458-518
Classification Level Classification E-value
Superfamily TPR-like 0.00000258
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383453632|ref|YP_005367621.1|
Sequence length 534
Comment serine/threonine protein kinase [Corallococcus coralloides DSM 2259]
Sequence
MDLQAGDVFGRYELVSWLGRGGMAETWHAQLVGDAGVTKPVLIKKVLPEYANDEAFISMF
ISEARISATLSHGNVAQVFDFGRVEGEYFLAMEFVDGQPLHRVLKRALRSDLGRMPIPIA
VFIAMEMCRGLHYAHTRTDGSGRPLGIVHRDISPDNVLLGYEGQVKIVDFGIAKAQLIRG
ISTEPGVVKGKFHFFSPEQARGEGVDARTDVWSTGVVLYELLCGKLPVEGPPAVVLSRVG
NGEIPSPATLRPDLPKELNDIVMKALTPDRQRRFDSSHAFGDALTAFLYANFPRFSSMSL
AHLLRVLFKEDLAQLGREPSVPGSFLEDLKAWSKPAAPARPVTPPAPPPVLQRQPRPVRP
SNPTATAMPAPRVPAPAPAPPKPLRTGLGVGALLAVAAGLVFLWRHQTATQPVEEPPPQP
MATLEPPSEPAPTPVAEVAPPPAAPSNEIMELRQQIQALVDEKNYDVALVKAQLCIKLDP
TFPDCERYLGFLYAELGDATLSEEHYKAYVKLAAEGDPARARVMEGLGKSGDAG
Download sequence
Identical sequences H8MYH4
WP_014394464.1.7229 gi|383453632|ref|YP_005367621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]