SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036874 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000036874
Domain Number 1 Region: 43-284
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.17e-85
Family Calponin-homology domain, CH-domain 0.00000228
Further Details:      
 
Domain Number 2 Region: 2413-2532
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-34
Family Pleckstrin-homology domain (PH domain) 0.0000671
Further Details:      
 
Domain Number 3 Region: 302-421
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-28
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 1556-1712
Classification Level Classification E-value
Superfamily Spectrin repeat 9.4e-27
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 5 Region: 820-968
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1715-1820
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-22
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 925-1074
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-22
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 1241-1393
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-22
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 9 Region: 1876-2032
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 10 Region: 605-713
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-20
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 11 Region: 1079-1182
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000444
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 12 Region: 727-827
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000641
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 13 Region: 2035-2096
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000403
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 14 Region: 1392-1506
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000544
Family Spectrin repeat 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000036874
Domain Number - Region: 559-606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00151
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036874   Gene: ENSXETG00000002566   Transcript: ENSXETT00000036874
Sequence length 2568
Comment pep:known scaffold:JGI_4.2:GL173045.1:485193:551927:-1 gene:ENSXETG00000002566 transcript:ENSXETT00000036874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVSPELDNMEVQTPPNNNNRWEQKEHPWDEPAATGKLFECSRIKALADERDAVQKKTF
TKWINSHLSKVPLRVNDLYTDLRDGYIITKLLEVLSGEQLPKPTRGRMRIHYLENVDKAL
QFLKEQRVHLENVGSHDIVDGNHRLTLGLIWTIILRFQIQVIRIETEDSRETRSAKDALL
LWCQMKTSGYPEVNIQNFTTSWRDGLAFSALIHRHSHRPDVIDFNKLTKSNATYNLQHAF
NTAEQQLGLTKLLDPEVLKDVNMEHPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLD
KAIETEKDIVKYEVLASELLEWIERTIAIITNQKFANSLLGVQQQLQVFTTYCTTEKPCK
FQEKGNLEVLLFSIQSKMREEKCKLYVPSEGKNISDINKAWACLEKAEHEREVALRNELI
RQEKLELLSQRFDQKAAMREAWLSENQRLVSQGTCQYHLILDVPVSLQATQFLTCSIHTC
KTLAENILRLIYKMQSRRKVQIVPPCKRKDNSCTVFTSWKLLTGHIQGIATNERQNRHQQ
AIYRERAFMALFTAYFQVPLSSKDFGKHLLEVEDLLQKHCLLEADIAAQTERVNSLNQAA
LKFTQMTDYQPCDPQVICNRVEHVRSCLEGLRQLAEKRRGELEESRRLWCFLQEVEEAEG
WIREKEQILSAPQSYGKDLSSVLRLLSKHKILVGELRGRHAMLQQTLQKGEQISFAGGCK
VLAKRRKGMSGLRQRMEQVRLKWENLQKACDNHQQKLQEASSFYQFSADTMELAGWLQDT
YRLVSSDDFGHDEYSTQSLVKKHRAETVEIEKHKVAVLGLRQQLSELGAEYRDQVDVQIT
IVEVEQLYGEVVEVSALRSQWLQDALDVYKMFGEVNSCEVWIDEKEQWLMKMEIPQRLEE
VEVVQHRFESLDQEMNSLMGRVLDVNQIVQQLLEGGHPSSSEVRACQDHLNSRWNRIVEL
VEQRKEQLSSVLRLQNYFLECNEVKSQIREKRRTMETPQCGSGELGGVLSLQRKLSSMEA
ALLALEPKLVQLQQDAEILATSHPSQAMEVLVHFEEISGEWDALKRTLQGCEDSLTVANK
LQQFIQDLDNFLTWLVKTQTAVAAEELPSNLAEAERLLGLHGSLKEEISRYEEEYNKIQA
VNDLLSLEEADLPYLSLQQWLQKLEVGWNKLLQMWENRREVLVQAHIFHLFLRDFKQAEA
CLNTQESTLAHVELPNTVEGVEAAIKKHKDFVTTMELNVQKVSVAVEAGESLIRLGNVFA
DHVQERISAIQKRSQRNTALAQKWLQRLRDHLQLQHFLQNCNELDAWVHEKTLMARDSSR
DLSQKPHKKWLKHQAFMAELSQNKGWLEKIEKEGQQLIQEKPELAGVVKKKLEEIRQCWV
ELESSTQAKAQQLFQATKADQVVQNYSELGKRLYHLKEQLQPVDPVPDVSSVNTQLKRLE
TMESQMEEWYKEVGELQAQIASLPLEVASQKALEEKQNEVGTTIVRLIEPLKERRRILLA
SKEVHQVTRDLEDEIFWVQERLPLATSKEHGSNLQIVQQLIKKNQNLRREIQVHSPRVDD
ILERAGAIASIRTPEAEGVRLGYESLGEMWNMLRDETERRQQLLDITYQVQQYYFDVGEV
ETWLSEQELLMMNDEKGKDEQSTLQLLKKHLMLEQTIENYEETIAQLSRQCRTLLDLGHP
DSEQISKRQSQIDRLYVSLKDLVDERKGRLEQQYWLFQLSREVDELEQWIAEKEVVAGSP
ELGQDYEHVTLLQEKFTEFATETGSVGQERISAVNQMVDELIDFGHSDAAIIAEWKDGVN
EAWADLLELMETRSQMLAASHELYKFFNDCKEVLSQVEEKKQRLPEVKAQEAKLSAGSLQ
RILSSFEHDIQVLVTQVRQLQENAAQLRTVYAGENAAAIVTSEQEVMRAWKELLTSCEDC
RLQITSTTDRIKFLNLVRDLISWMESITCQIGAEEKPRDVSSVEVLMSYHQGLKSEIESR
NKRIADCVELGKTLVLNKRPSSDEIKQSLDRLMAKKKEMLEKWNKHWEWLQQMLEVHQFA
QEAGVADAWLTAQEPIVKSPELGNSVDEVEQLIRRHEAFRKTAAVWEERFSSLRRLTTLE
KLKAEQSKQPATPLLGRKVFPDTTDYSARPSPLSRQTVYENSETKLDQKEALSIPDGGQQ
EIRRARAEKGETRVGYVRQDIKPERLQPKMDHVETKVADKPLAAQEVERAEKTEIKFAQG
MANLTVEKPEIKGSRHTERKRDRHERRLERQESSEQETPKQEPPERRRDRHEKRLERQGS
SEQETPKQEQSERRRDRHERRTERQDTIEQDKPRTEPEKQAGKATLADIVEQLQEKEAFQ
NSSGGQGLPEKGQDSPARVPNGVDKLPERTTRPDRPRARDRPKPRRRPRPKDPNQPPGEA
RRSRSAPAQSSAPPPPPPTHTIQQEGYLFRKHELDGPSKKASNRSWINLYCVLNKGDLGV
YKDAKSQSSGATHGGEPLLNLLGASCEVASEYKKKKFVFKLRSTDGREFLFQAKDEEEMK
NWITAITTCVSQHAEIARWSQSLLTTSSTDEGNIKRETERRPSGGGRK
Download sequence
Identical sequences F7AN80
ENSXETP00000036874 ENSXETP00000036874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]