SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000037611 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000037611
Domain Number 1 Region: 46-111
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 3.53e-20
Family Anaphylotoxins (complement system) 0.0017
Further Details:      
 
Domain Number 2 Region: 369-403
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000000994
Family Complement components 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000037611
Domain Number - Region: 197-230
Classification Level Classification E-value
Superfamily E set domains 0.0364
Family SVA-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000037611   Gene: ENSXETG00000030321   Transcript: ENSXETT00000037611
Sequence length 404
Comment pep:known scaffold:JGI_4.2:GL173333.1:77724:97911:1 gene:ENSXETG00000030321 transcript:ENSXETT00000037611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GANTAGVFYDAGLALQTSFSVKTDQKNRKPQCKDRAPRRRRTTVALMEIKTGKASEYKDK
VKQCCLDGMQENLMGHSCERRTRYILDGKECVDAFLDCCKYYEKRREDERKSKDEDTLAR
NQEDSGYMLYSEIDIRSDFPESWYWKVEEMTGAPDKDKISTKILNVHLKDSITTWEVLAV
SLSENKGLCVAPPHEIKARKDFFIDLKLPYSVVRNEQVEIRAVVHNFNNNRIKVLVEFGY
NKEFCSLSKPKQKFRAEVWVGAESSAVVPFVIVPLELGQHDVEVTAAVYKQFVSDGVSKK
LNVVPEGMLLSKTLNSVTLEPEVKGKGGVQELEIKALTAPNIVPKSDIDIKVILQGTPIS
QLVESAIDGSNLHHLIQIPDGCGEQNMMRMTTNVITTRYLDATA
Download sequence
Identical sequences F6VGR4
ENSXETP00000037611 ENSXETP00000047208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]