SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059587 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059587
Domain Number 1 Region: 8-163
Classification Level Classification E-value
Superfamily PH domain-like 7.52e-44
Family Phosphotyrosine-binding domain (PTB) 0.00000223
Further Details:      
 
Domain Number 2 Region: 189-295
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-19
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 288-369
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000631
Family PDZ domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059587   Gene: ENSXETG00000030272   Transcript: ENSXETT00000062073
Sequence length 378
Comment pep:known scaffold:JGI_4.2:GL173404.1:311546:323705:1 gene:ENSXETG00000030272 transcript:ENSXETT00000062073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGPCDPEDLKDGVIFGAQYLGSTQLPGEKHPVASTRMRQAQEAVDRIKTSGKCTRSRPN
APDGESQPMTEVDIMVSTRRVKVLSADSQESLMDHPLHTISFTADIGSIVVLMARRKIPR
TQDQSPTQRKPNRILCHVFQSDDAQLIAQAIGQAFGLAYQKFLCSDRVGPLTSGSGQREE
HLYNADLPHFSKSDSCREVYIQKQRGEMLGIAVVESGWGSLLPTVVIANLMHGGPAERSG
DLSIGDHVTSVNGTSLVGLPFSTCQGLIRDLKGQSEVILSIVRCPPVITAIIQRPSVSHQ
LGFCVEDGVVSLIRYHTYINGXIRVGHRIIEINGQSVVATAHEKIIQTLMDATGEVHIKT
MPASTYRLLTGQEIPVYL
Download sequence
Identical sequences F6Q2L1
ENSXETP00000059587 ENSXETP00000059587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]