SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061237 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061237
Domain Number 1 Region: 63-182
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 5.41e-34
Family Interleukin 17F, IL-17F 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061237   Gene: ENSXETG00000033334   Transcript: ENSXETT00000063069
Sequence length 216
Comment pep:known scaffold:JGI_4.2:GL172965.1:1076135:1083625:1 gene:ENSXETG00000033334 transcript:ENSXETT00000063069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCMTVVWMLKAAMMLLFGILIASCNGSKPVKRPPPKPKSCADRPEEHLEQVYGRLAAGML
SAYHHTLQLQPLDKENISCPAGTQGRGAGDGKQRLPVNIHSISPWAYRISYNPTRYPKYI
PEAYCLCKGCLTGLLGEEDLNFRSMPVYMPTVILRRTTSCAGGRYVYEEEYITIPVGCTC
VPEQEKGAELLESVNSSLEKEKFKLPLNKSEKPLAN
Download sequence
Identical sequences F7AI18
ENSXETP00000061237 ENSXETP00000061237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]