SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000120 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000120
Domain Number 1 Region: 700-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 758-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000275
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 369-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000292
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 536-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000477
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 454-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000677
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 6 Region: 627-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000403
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 7 Region: 833-884
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000935
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000000120
Domain Number - Region: 427-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00489
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 190-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00705
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.019
Family Viral histone H3 Lysine 27 Methyltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000120   Gene: ENSXETG00000000068   Transcript: ENSXETT00000000120
Sequence length 1151
Comment pep:known scaffold:JGI_4.2:GL173384.1:306273:326303:-1 gene:ENSXETG00000000068 transcript:ENSXETT00000000120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEPMDEAVFIWCDDCGQYHDSECPELGPVVTVQDSFVLSRARSSLPSNLEIKQAEDGA
EGVFAVTPLVKRTQFGPFESKRVSKLDKEPRFLLKVFHKDGRSELCDTSSEDDCNWMMFV
RPAADFTHQNLTAFQHGNDVYFTTSQDIALGAELRVWYAAFYARRMEKALLKPAIPCHSV
SCQDNSDIIHVETCHWTCKVCSTTFIEPNLLTEHLLSHLEQAKGIPPPTQCENSYLECDT
VSVSADQTVICADSNQNLEVKKKPKRGRKSKVPKGNIPLVIVDDDSPADRVAEIITEIPP
DDVQLPHDPEDKFMELMLGKLPNAANSLPPVSKFAFHQTSSSVKRSMLLPGSRHAIRRKF
ARQLGDHKRVFQCNICAKVFRNSSNLSRHVRSHGDKLFKCEECSKLFSRKESLKQHVSYK
HSRNEVDGDYRYRCNTCEKAFRIQGFLEFHNCRTDDKSFQCEMCYRFFSTNSNLSKHKKK
HGEKKFACEICNKLFYRRDVMLEHHRRHLEGAGVRRVKRESLHQNTDNSIRYKKEPSACP
VCGKMFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHIHFKDIALMNDQQREE
FIGKIGISSEDNDENSDGSVETEPHKYSCKRCQISFARGKEYLKHIMDIHAENGYDCSIC
HRRFALKATYHAHMVIHRENLPDPEVQKYIHPCEVCGRIFNSIGNLERHKLIHSGVKSHG
CEQCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECMEC
HRRFAQKVNMLKHYKRHTGIKDFMCELCGKTFSEKNTMETHKLIHTAPNKVGKQWTCTVC
DKKYVTEYMLQKHVQLTHDKVEAQSCNLCGTKVSTRASMSRHLRRKHPEVLSVRIEDLDD
LQESEAIDTSLSIVQRELDVEEHEGLQRAKRMRTGTSRAGKRKSREEDAEDPEDPTFTEY
QEKESEFTRSSGDEDGSAVETLQQVVVTISDGSVPAPSCTVGLTNITVTPITTTAGTQFA
SLQPVAVGHLAASERQLQLDSSILTVTFDAVSGSAVLHNRPAELAIAASQDAAGPQPVAH
FINLTTFVNSIAPLGGQISSEAPLTWRAVPAGETPPHPEEDQPSEQTEQQSSGPHTVQEV
PPDTQGQMYSY
Download sequence
Identical sequences F7C1V5
ENSXETP00000000120 ENSXETP00000000120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]