SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000001115 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000001115
Domain Number 1 Region: 315-477
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-51
Family Kelch motif 0.0000195
Further Details:      
 
Domain Number 2 Region: 440-600
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-45
Family Kelch motif 0.0000169
Further Details:      
 
Domain Number 3 Region: 45-163
Classification Level Classification E-value
Superfamily POZ domain 9.42e-36
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000001115   Gene: ENSXETG00000000516   Transcript: ENSXETT00000001115
Sequence length 611
Comment pep:known scaffold:JGI_4.2:GL172721.1:2328735:2358906:1 gene:ENSXETG00000000516 transcript:ENSXETT00000001115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRKPMRRCLSTRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYVSDKHPRQTLEVINL
LRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAME
LLIDFSYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTH
SCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVK
YSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQER
PLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGV
SVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGG
QDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTAIVE
RYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVV
AMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGV
IKMTHCESHIW
Download sequence
Identical sequences F7DPQ6
ENSXETP00000001115 ENSXETP00000001115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]