SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000001746 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000001746
Domain Number 1 Region: 194-408
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-77
Family SSRP1-like 0.00000745
Further Details:      
 
Domain Number 2 Region: 509-590
Classification Level Classification E-value
Superfamily HMG-box 7.99e-26
Family HMG-box 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000001746   Gene: ENSXETG00000000781   Transcript: ENSXETT00000001746
Sequence length 606
Comment pep:known scaffold:JGI_4.2:GL173234.1:324454:373877:-1 gene:ENSXETG00000000781 transcript:ENSXETT00000001746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLEFNDIYQEVKGSMNDGRLRLSRAGLMYKNNKTGKVENISAADIAEVVWRRVALGH
GIKLLTNGGHVYKYDGFRDTEYDKLFDYFKSHFRVELVEKDLCVKGWNWGSVRFGGQLLS
FDIGDQPAFELPLSNVSQCTTGKNEVTLEFHQNDDSEVSLMEIRFYVPPTQDDGGDPVEA
FAQNVLSKADVIQATGDAVCIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDMTLTLNMSEEEVERRFEG
KLKKNMSGCLYEMVSRVMKALVNRKITVPGNFQGHSGSQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEVNCVNFARGTTTTRSFDFEIETKQGSQYTFSSIERLGMKPAYDDYAD
SDEDQHDAYLERMKEEGKIRENADSDESGDETDESFNPGEEEDEVAEEFDSNPSASSSSA
DSDDDAEKKKEAKRAKIVKEKKPRKKKESKKTKDPSAPKRPMSAYMLWLNASREKIKSEN
PGISITDLSKKAGEIWKSMSKDKKEEWDRRAEEAKRDYEKAMKEYNSSTPTEASKKEKKA
KGEKKK
Download sequence
Identical sequences F7E2T1
ENSXETP00000001746 ENSXETP00000001746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]