SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000003091 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000003091
Domain Number 1 Region: 974-1097,1263-1415
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-34
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 2 Region: 5-113
Classification Level Classification E-value
Superfamily Sema domain 6.8e-21
Family Sema domain 0.017
Further Details:      
 
Domain Number 3 Region: 459-546
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000149
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 4 Region: 555-637
Classification Level Classification E-value
Superfamily E set domains 0.0000000000121
Family Other IPT/TIG domains 0.095
Further Details:      
 
Domain Number 5 Region: 116-159
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000003091
Domain Number - Region: 641-681
Classification Level Classification E-value
Superfamily E set domains 0.000111
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number - Region: 275-321
Classification Level Classification E-value
Superfamily Plexin repeat 0.0196
Family Plexin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000003091   Gene: ENSXETG00000001467   Transcript: ENSXETT00000003091
Sequence length 1487
Comment pep:known scaffold:JGI_4.2:GL172832.1:1652638:1703410:-1 gene:ENSXETG00000001467 transcript:ENSXETT00000003091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQLQEEQLDCGAAHLQHPLAITRPLPAVPIYKEKGLTSVAVANVSGYMVVFLGNVSGHLI
KINLDADMKIINKSMQYLEIASGQPVHHVMEFDPMDPTYLFVMTSHQMTRVKVAECAKYR
SCTECLAAADAYCGWCTLEGRCSLQKECQGSEDSAFWMSPNVGQENMCPAMNSIPNKIDI
SSSTQRIILQITGKLPILYQMNVSCDYGNNIITPAVIDPDQDSGQLLHCSFLPRDQFPSF
PPNQDYVTVSMALSVGGNSIIQHKFIIYDCNRTQNMHPKNACTSCVKSRWPCSWCVSQHR
CVSSASQCDTIAQNSTESCPRITATSLTPTPTGVTKDYTLSLLNTNITEGPKLECDFGTE
QTFPAKWLNSSAVVCSNVLLYTSERTQSFPINLQLSDHKGLYLDNPSMLSVEVYNCASQT
PDCSSCLGRADLGHHCSWSESSMSCRLNSEILSISHPYTCPAPDIRKIDPASGPLLGGTL
VTIQGRNLGSRFSDINGRVKIGEIECTPIQEKYIVSEEIVCMTGESPKLLTDWVSVDVNG
GGRSKEKYSFQVPEVDYLSPDFGPWAGGTRVTISGTNLNIGRDVRVLFNKTQECRDLVRT
QSTIQCTVPPMKFLPETKVHICVQFEKKSCVKEELFFKYQENPVIKSMDPRSSPLSGGRI
ITVTGERFDMVQSIMMGIQHEKGRRMVSRPVQVCNMFSKGRIIFHSMKINICGQVMMDLG
KAIVEAHFSLEYQPDPMFYTAKKEKLIKHHVGEPLTLVIHKEPDNLGLRVDEYRVKVGQI
PCESIFIFNDKVIHCSINESLSSSQRYLPVTIQVGKFNQTITTLHLAGIDTSIIISIVIC
SILLLLSVVALFVFCTKSRRAERYWQKTLVQMEEMESQIREEIRKGFAELQTDMTDLTKE
LNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYILPTQNFNTQLGFQVPETHPLLCGEWKV
PENCRTNMEEGITLLSTLLNNRHFLVTFIHAVELQKDFAVRDRCNLASHLTIALHGKLEY
YTSIMKDLLVDLIDSSASKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLL
CAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPMNLNVSFQGCGMDSLCVRVLDTD
TVSQCKEKILEAFCKNLPYSQWPRVEDVDLEWFASSSKSYILRDLDDSSIMEDGKKKLNT
LAHYKVHDGASLAMSLKDKRDDTLGRVKDLDTDKYFHLVLPTDDLAETKRSHRQSHRKKV
LPEIYLTRLLSTKGTLQKFLDDLFRAILSIHEDRPPLAIKYFFDFLEEQAEKRGISDPDT
LHIWKTNSLPLRFWVNILKNPEFVFDMDKSDHMDACLSVIAQAFIDACSISDMQLGKDSP
TNKLLYAKEIPEYRKIVQRYYQKIKEMSPLSEQEMNAHLAEESRKYRNKFNTNVAMAEIY
KYAKKYRTQIVTALETNPTTKRGQLQHKFDQVIVLMEDDIYSCSSEA
Download sequence
Identical sequences F7BMT3
ENSXETP00000003091 ENSXETP00000003091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]