SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000004154 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000004154
Domain Number 1 Region: 146-173,220-462
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-80
Family Eukaryotic proteases 0.000000888
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily GLA-domain 2.86e-25
Family GLA-domain 0.00027
Further Details:      
 
Domain Number 3 Region: 125-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000004154   Gene: ENSXETG00000025492   Transcript: ENSXETT00000004154
Sequence length 464
Comment pep:known scaffold:JGI_4.2:GL172678.1:155555:165769:-1 gene:ENSXETG00000025492 transcript:ENSXETT00000004154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQTCLIILIALPAVLLQQSPNVFLKHENAHNILRAKRANSAFEEFKKGNLERECYEER
CSLEEAREVFENEEQTREFWSKYFDGDQCQSNPCQYGGSCNDGINEYTCLCNAGFEGKNC
ETVKLQLCSLNNGECDQYCKAVDRDVVCSCTNGYILGENGKSCLPTEKYSCGRRHMKRER
RETKLHENDKKNHTDSQNEVKMNQTGTLPERNVTGINILNPNDPNVRIVGGRECSQGECP
WQALLVSDEDEGFCGGTILSREFILTAAHCMNQTKYFKVVVGELNTKISEGTESIHKVEK
IIMHPRFVKSTYDYDIAVIKLKEAINFTENIIPACIPDPEFADQVLMNEPDAMVSGFGRI
HERGRQASTLQMLQVPYIKRHSCKESSTFAITENMFCAGFDTEVKDACQGDSGGPHVTPF
KGTYFVTGIVSWGEGCARKGKFGVYTKVSKLHRWLKGVLKKNQV
Download sequence
Identical sequences Q5FW21
gi|58477045|gb|AAH89660| gi|62751697|ref|NP_001015728| ENSXETP00000004154 NP_001015728.1.99540 ENSXETP00000004154 8364.ENSXETP00000004154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]