SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000004549 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000004549
Domain Number 1 Region: 5-17,53-80,195-393
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.15e-53
Family Nuclear receptor ligand-binding domain 0.000000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000004549   Gene: ENSXETG00000002131   Transcript: ENSXETT00000004549
Sequence length 400
Comment pep:known scaffold:JGI_4.2:GL174089.1:26325:32489:1 gene:ENSXETG00000002131 transcript:ENSXETT00000004549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSILAVKFGRMSKKQRDLLQQEVRRMEEQRMLPTSIACSAGSHGDKTALPSSSELPSPFV
SASWTGHGKWDTSCSVRPCPVPRTHPPIQSHHPEKIQTEAVSRKSCFRDHQPYLEHSRLN
IFQRLPPTLQSPECYGSPNFSSCLLSERLISAVELAADLLMQNVVGAYRETCKLHQESLQ
AMRWETFTPAEIQSFQQKTMDQMWERCVCHITDAIQYIVEFAKRLSGFMELNPNDQIVLL
KAGAMELLLIRMSRAFNCYNSTIYFEGKYAPLDLFQSLGCNDLISAMFDLCHSLCALNLS
EHEMAFFSSMVLLDPSQPWLQEKEKVESLHMKLDLSFRQLLRRTRRESIICKLPQRGRLL
GICQLHMEKLNIFRQMYPGIAWERFPPLYKELFVSDTESS
Download sequence
Identical sequences F6QSC9
ENSXETP00000004549 ENSXETP00000004549 8364.ENSXETP00000004549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]