SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000006649 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000006649
Domain Number 1 Region: 319-448
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-27
Family Ran-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000006649   Gene: ENSXETG00000003053   Transcript: ENSXETT00000006649
Sequence length 450
Comment pep:known scaffold:JGI_4.2:GL173822.1:551:6557:1 gene:ENSXETG00000003053 transcript:ENSXETT00000006649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIADKELTDRNWDQEEEAEDAGTFSVASQEVMKTREIKKAKRRNLGSDGERGGAFKG
FKGLFSGTGASLPSFGNGSSXXXXXXXXXXXXXXXSTSLFINLKPASESKPTFGSAFTSR
PLLGAADKPLGTASTNGERALSTSGAALSKAGNSEYNKHLTSLNCSVRDWIVKHVNTNPL
CDLSPIFRDYEKHLSAIEQKYGASSDSGSESDGAAQTKTIPTLHSIKADPIATFSFGSKD
KAPGVPVKTPPDSKPQAAAPTFNFGQKVDSSTLSLIGSGGAPSFSFSTGASSLFGKSTGS
TASSSQESEPSSNTEGKGDGEEEEEPPKAVIQEVKEDDAFYSKKCKLFYKKDNEFKEKGV
GTLHLKPVENKKTQLLVRADTNLGNILLNILVQPSMPCSRTGKNNVMVVCVPNPPIDEKN
PTVPATLLIRVKTAEDADELHKILLEKKEV
Download sequence
Identical sequences F6SS80
ENSXETP00000062350 ENSXETP00000006649 8364.ENSXETP00000006649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]