SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000011393 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000011393
Domain Number 1 Region: 104-118,157-409
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-65
Family Nuclear receptor ligand-binding domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 34-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000011393   Gene: ENSXETG00000005219   Transcript: ENSXETT00000011393
Sequence length 409
Comment pep:known scaffold:JGI_4.2:GL172739.1:742784:749899:-1 gene:ENSXETG00000005219 transcript:ENSXETT00000011393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGIGTMSSPTGSVLSTEDSQSVPSPAPGPAPNPLLLCRVCGDSSSGKHYGIFACNGCSGF
FKRSVRRKLIYRCQAGTGLCPVDKAHRNQCQACRLKKCLQTGMNKDAVQNERQPRSTAQI
RLDSIDLDTDSRSEHLATTRDPPPSCPQGNNLRTPIPSAISGTLSPPHNHRFMASLMTAE
TCAKLEPEEADENIDVTSNEPERTPTDFQISGFPTSSPEGVYETSARLLFMAVKWAKNLP
VFSNLPFRDQVILLEEAWSELFLLCAIQWSMPLDSCPLLSVPDLSSQVHGKSVSSTIDVR
ILQETISRFKSLNVDPTEFACLKAVLLFKPETRGLKDPEQIENLQDQSQMMLAQHTRNQY
PAQPVRFGKLLLLSPSLRFISSERIELLFFHRTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences L7N2T2
ENSXETP00000011393 ENSXETP00000011393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]