SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013027 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013027
Domain Number 1 Region: 219-354
Classification Level Classification E-value
Superfamily AXH domain 4.71e-49
Family AXH domain 0.00079
Further Details:      
 
Domain Number 2 Region: 438-519
Classification Level Classification E-value
Superfamily HMG-box 1.44e-19
Family HMG-box 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013027   Gene: ENSXETG00000005922   Transcript: ENSXETT00000013027
Sequence length 531
Comment pep:known scaffold:JGI_4.2:GL172681.1:3084987:3099032:1 gene:ENSXETG00000005922 transcript:ENSXETT00000013027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWEVKANDMPNAVQKVQLVMDNRHTGISESLEMLKCNEHIPSSPGYESSDDHMELDNNM
MGHIHQSTTSNPEMDDIPELRTVPADSTSPEVFHLDSGISHQEYTVPSWSQNTSDISENE
YSCDTGMNWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVPTESKS
NVSRSHWREETMVRHERTNSESESGIFCMSSFSDDDDLGWCHSWPQTVWHCFLKGTRLCF
HKGRKKQWQDVEEFAKSTRCRNERGIDSYKGYGSDGLKLVSYEECVSYGESVLQLTFDPG
TTDGGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEIHVGDVCLPPGHPDAINF
DDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASSNGRASSPESERSEYCKDYASPRSS
QTSCSSLCNKTGRNHTSGTANSVPVTSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRA
ISVILGDRWKKMKNEERRIYTIEAKALAEEQKRLNPDCWKRKRTNSGSQQH
Download sequence
Identical sequences Q642N2
ENSXETP00000013028 8364.ENSXETP00000013028 gi|51895864|gb|AAH81362| ENSXETP00000013027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]