SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013873 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013873
Domain Number 1 Region: 36-329
Classification Level Classification E-value
Superfamily L domain-like 1.42e-54
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 434-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000268
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013873   Gene: ENSXETG00000006330   Transcript: ENSXETT00000013873
Sequence length 638
Comment pep:known scaffold:JGI_4.2:GL172724.1:149285:154802:1 gene:ENSXETG00000006330 transcript:ENSXETT00000013873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRMEFLVQITMRCLHLLILLLAFDNLVSTIPATTQCPENCTCLPLQQHVLCGNASLTSVP
SNVPNNTVELHLQNNLFSELHDSFLQDLPELRGLYLSNCEIDTIKPEAFQKVTSIKYLHL
DRNHLGDLQEGTFRNLSSLIYLHLESNQITSIREGLFAPLEKLSALYLSNNLLQELTDGS
LNGLTQLRWLDLGFNMLSKISNQSFTAIANLRKLNLERNNLTSIPSAIRRRTGLQMLRLS
GNSIKKLSSSSFGRSLRFITELYLDSLRLEKVTSMTFSKLRMLKVLDLSNNSLQSLSVYN
VKIFTKIYLTGNPWRCDCSLIGLHTRLQQTKNLDAEQQAHCDAPKALKGQSLINVNLLKL
TCPATGEDISVTASTPSLLGSSQFANTSIRSVVETMKPTTHAYKTSPQAMSHSTAGNNKI
EAEEQDPCLAKHISNVVVRPVEKESLDVSWSIHGDYKQFEIRYSTEEEKSSLNIIGDLPN
IRLYHLNPGSSYRVCIVPQNVDIVKCQLAKTRQCADGQTADVPEQAYHVYSPPKSTSPIV
TVGVSVGLIVLVAATIFAVYMLRSHKIQFQRYYNEDGAEGSRKQETDPYKWDGVYENIDD
DRHVYVTAASLWGMDNEILDCALAEPNSLSSVPKYQTL
Download sequence
Identical sequences F6SBL4
8364.ENSXETP00000013873 ENSXETP00000013873 ENSXETP00000013873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]