SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013876 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013876
Domain Number 1 Region: 44-146
Classification Level Classification E-value
Superfamily TPR-like 5.26e-16
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 2 Region: 837-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000123
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 3 Region: 896-927
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000173
Family CCCH zinc finger 0.003
Further Details:      
 
Domain Number 4 Region: 764-794
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000267
Family CCCH zinc finger 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000013876
Domain Number - Region: 620-652
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00283
Family CCCH zinc finger 0.0065
Further Details:      
 
Domain Number - Region: 498-526
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00345
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013876   Gene: ENSXETG00000006332   Transcript: ENSXETT00000013876
Sequence length 966
Comment pep:known scaffold:JGI_4.2:GL172724.1:177496:200236:1 gene:ENSXETG00000006332 transcript:ENSXETT00000013876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVVLMARQKRKEDIEKGLQFIQSTIPFHGSHADYEHFLQQLVRNLFAEGNDLYRDGDAK
LALGQYTEGLTVAEYAVSEELTIPEELLSKLCVNRSCCYFTMGLYEKSLEDSESALNHDK
ENMRALYRKAKALDQLGRHQEAYGCISDKLLALVQDESVTELAQELVQKLGLKQRKAYKR
PQVLLHCYLGETAAVQKKSINQNLQVVKSMHYIAGRQLWVTTHFMCLLPTDASSNSLGSL
DDIDVGSDLHIEGLKAAGSPPSTGFPSAAGSLNDFADCDIIGDELDSFLDAGIPVYTTGS
TLLSSLGNNVLPAPSPLPPASFGLLDSQKLTRHCDKPGYNSNLLRLVEPRLDALDSFEGI
REPMDCLDTFPNGNEETDSLILHFEEPKHLLSPSAKTSQKHKPGVNNINHIKMDAAVLHA
RALLPTPLANSLAHTYDFKQACHQCFVKTGPKALDYAHREKLEHKCKRNILLARQKTSEN
KTWLRIRPRPPKVTGPYVLCKDIQTRQDCKYREDCTFAYYQEEIDVWNEERKLTLRRDQL
FLLPSGVKAGTVTWLLQEHKGIFIFLCQACFDSKPRVISKKSQENPSVCTKQHYFLDNKC
LVHVYNCDTIKYSKIRPLQSHYHMDLCRHEMQYGCLQEDTCSFAHSHVELNVWILQRQSG
TTQEEIVQESEQDWKVPETKMPGCRILYHPQALPKCLDMKMKFVCSQCLSTGQHIESDRD
GKYCAAKARHSWTKEKRVLLVMSKAKKKWVSARPLPSIRQFPQHYEICIHVQNGKKCQYS
GNCTFAHSTEEKDVWTFMKDNKVLDLQLVFDLCQKNNCPPEKAEKGASGPQKETEKQILM
PTDYADLMAGFHCYLCGKNSNSERQWQKHIRSEKHKDRVFTTESEDTTWKFRFPAGEFKL
CDRFEETKDCPHESNCQFAHGQEELDEWLKRRDVLLQKVSKARKDMLLEPTDSDFGKYTF
LLKDVA
Download sequence
Identical sequences F6SBJ6
ENSXETP00000013876 ENSXETP00000013876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]