SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000015496 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000015496
Domain Number 1 Region: 444-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-21
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 332-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 388-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000106
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 57-99
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000418
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000015496   Gene: ENSXETG00000005126   Transcript: ENSXETT00000015496
Sequence length 539
Comment pep:known scaffold:JGI_4.2:GL172875.1:1211360:1217538:1 gene:ENSXETG00000005126 transcript:ENSXETT00000015496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERILTHALEIIYLLKGEVLLPNHLCDSVMNSAVNEDKELQIEGILTHALEIIYLLTGQVP
IKSGDVAVYFSMEEWEYIERHKKNYKDTIVDTNQQRVPLCICLMEIKITSFILSHTHCTQ
THLLSDISFCTDNFWMSSCAFCVNHNFLHCFVDNDQSRNILDDPRTSTNTSGMITQDTSM
SFNATDLSSLESGNHPSIIQNTIAQKVQFLKGSKHNVGDITMPKQKGRHKRTCSDRRPFK
CNECGKQFLFVEKLRLHQNTHTKKKSYACRKCKKSFSSRLLLFTHKKVHKQERPHVCSEC
NKGFQKRSLLVRHQRTHTGVKLFSCNECGKRFSQRSNVTRHYRIHTGERPHICSECGKCF
GQLSCLKTHRRTHTKEKPHVCAECGKCYSDRSDWFRHVKTHTGEKPYPCPDCGAGFIRRA
SLDRHRRVHTGEKPFACTICAKCFPYRSTLRLHQRTHTKERPYTCTECAKCFAQRSALNA
HQRTHTKEKPYQCTECGKHYSDRGVLVRHHKIHTGEKPFACPLCGKCFNDKSHMVRHHK
Download sequence
Identical sequences F7AX04
ENSXETP00000015497 ENSXETP00000015496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]