SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000015932 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000015932
Domain Number 1 Region: 29-151,180-545
Classification Level Classification E-value
Superfamily Sema domain 4.58e-178
Family Sema domain 0.0000000000479
Further Details:      
 
Domain Number 2 Region: 608-690
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000845
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 541-592
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000453
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000015932   Gene: ENSXETG00000007312   Transcript: ENSXETT00000015932
Sequence length 772
Comment pep:known scaffold:JGI_4.2:GL172795.1:1720256:1737278:-1 gene:ENSXETG00000007312 transcript:ENSXETT00000015932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLIDPILLTPTNSWPKTSINLPLPASTLWHTPLTDLKASGTAHFLSFLLNTTDYRILLKD
EDHDRMYVGSKDFILSLDLQDINREPLIIHWPASQQRIEECVLSGKDSNGECGNFIRLIQ
PWNRTHLYVCGTGAYNPVCTYINRGRKAQASELSHTPGGRGSRAADSLLSPTPADHKDYV
FYLEPDRVESGKGKCAYDPKLDSVSALINEELYSGVYIDFMGTDAAIFRAMGKQAAMRTD
QYNSRWLNDPAFVHVHLIPDSADRNDDKLYFFFREKSTDSPHSPTVYSRIGRVCLNDDGG
HCCLVNKWSTFLKARLICSVPGADGIETHFDELQDVFIQQTQDNKNPVIYAVFSSSGSVF
KGSAVCVYSMSDIRMVFNGPFAHKEGPNYQWMPYTGKIPYPRPGTCPGGTFTPSMKSTKD
YPDEVINFMRTHPVMYNPVYPVHRQPLLVRTNVNYRFTTIAVDQVDASDGRYEVLFLGTD
KGTVQKVIVLPKDDLETEELILEEVEVFKVPAPIKSMKISTKRQQLYVASMSGVTHVALH
RCDVYGEACADCCLARDPYCAWDGKTCSRYSASSKRRSRRQDVRHGNPMRQCRGYNSNAS
KNGVDGVQYGVEGSSAFLECQPRSPQAAVKWILQKDNTDRKKELRSEGRFLKTEQGLLMR
SLQLSDSGVYHCTATENSFKHTVMRVRLHVLGADAVTAALLQPEPPVALATNPAGPPGAY
DDLVQLLSQPEMGLLNQYCQGYWRPPGSTQTDAKEFQDQKRARNRRNHPPTG
Download sequence
Identical sequences F6PN39
ENSXETP00000015932 ENSXETP00000059604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]