SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017194 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017194
Domain Number 1 Region: 115-167
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000034
Family Hairy Orange domain 0.0000621
Further Details:      
 
Domain Number 2 Region: 49-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000615
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017194   Gene: ENSXETG00000007864   Transcript: ENSXETT00000017194
Sequence length 304
Comment pep:known scaffold:JGI_4.2:GL172861.1:857971:861645:-1 gene:ENSXETG00000007864 transcript:ENSXETT00000017194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGHDYSSSDSELDENIEVEKESADENGNLSSAAGSMSPSTSSQILARKRRRGIIEKRR
RDRINNSLSELRRLVPSAFEKQVIQQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHA
LAMDYRSLGFRECLAEVARYLSIIEGMDTTDPLRVRLVSHLNNYASQREAANTAHTGIGH
IPWGGTFAHHPHLSHPLLLAQTAHTSANSTSSSTEAHHQNRLPGSPHAETSSLRVPPNGN
IASVLPVVASSKLSPPLLSSMASLSAFPFSFGSFHLLSPNSLSPTTPTPSGKPYRPWGTE
IGAF
Download sequence
Identical sequences G1K3D1
ENSXETP00000017194 ENSXETP00000017194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]