SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017859 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017859
Domain Number 1 Region: 256-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-23
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 10-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-20
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 312-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 163-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000111
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000017859
Domain Number - Region: 353-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0256
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017859   Gene: ENSXETG00000008144   Transcript: ENSXETT00000017859
Sequence length 402
Comment pep:known scaffold:JGI_4.2:GL180990.1:5078:7774:1 gene:ENSXETG00000008144 transcript:ENSXETT00000017859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAVPSKEPLCLQEPVSFAEVAVYFSREEWALLDPAQRALYRDVMLETYQCVAWLGGLLVL
STVIKASESVLARKQQQEGTGITDILEDVQEGGVAERRWGSACVGEMRRDVPGGLEQGQG
EHIKKALGEHLEEKGRSPLDFNIGEKQAEGPRSKDVCPMKKQNPCTECGKSLEINSSVIN
HQCMYAMKRLYKCSECGKSFKRSYQLTRHQHIHTGWRPFQCSDCGKCFSRSSYLTCHQRI
HTGERPYRCSECGKRFKSSYELKQHQRIHTGERPYKCSECEKSFKSSTELKVHQRIHTEE
RPYTCSECGKCFSRSSHLTCHLHIHTGERPYKCPVCEKSFKSSSALKRHQRIHTGERPFQ
CLIICSKKGRASSACVRRLEIHSGQRPIEVPALQEELHPELN
Download sequence
Identical sequences F6UXL4
ENSXETP00000017859 ENSXETP00000017859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]