SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017869 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017869
Domain Number 1 Region: 238-469
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.96e-63
Family Nuclear receptor ligand-binding domain 0.0000000987
Further Details:      
 
Domain Number 2 Region: 17-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017869   Gene: ENSXETG00000008148   Transcript: ENSXETT00000017869
Sequence length 469
Comment pep:known scaffold:JGI_4.2:GL173046.1:801397:820259:1 gene:ENSXETG00000008148 transcript:ENSXETT00000017869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INKYINSLFVLTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNANYSCSRQR
NCMIDRTNRNRCQHCRLQKCLELGMSRDAVKFGRMSKKQRDSLYAEVQKHQQNQEQVLAR
DTKDTVSRSYSTGTSSCLSDLEELSGLSDGLLFDFPLTPDGCSSYYSLELPLSTEPSPDP
SHGTTLDELPVHYSLGLIEDQTLLDLNGIPNKLYYTPFSSVDPASVCPIFPIEYVSQNII
RSHLGTCQFTSDELSKMVWNAHSQEEVCSLQSKPCEMMWQLCAIHVSNAIQYVVEFAKRL
DGFMELCQNDQIVLLKAGCLEVLLIRMTRAFNPSNNTVLFEGKFGGIQMFRSLGCDDLLF
AIFDLGQALCRLSLSDEEIALFTAAVLMSPDRPRLTESKKVQKLQDRIFLALQKEIQKRH
CSEDLLTKMISKLPLMKTICNLHADKLEFFRILHPDTAHIFPPLYKEVF
Download sequence
Identical sequences F6UX65
ENSXETP00000017869 ENSXETP00000017869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]