SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000018759 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000018759
Domain Number 1 Region: 84-95,187-425
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-51
Family Nuclear receptor ligand-binding domain 0.00023
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000018759   Gene: ENSXETG00000008578   Transcript: ENSXETT00000018759
Sequence length 435
Comment pep:known scaffold:JGI_4.2:GL173569.1:31657:61477:-1 gene:ENSXETG00000008578 transcript:ENSXETT00000018759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTWEDDRVDQRACLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSR
KQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISDEEIERIMSGQEFEEEA
NTSWSNNGDSDHSSPGNGVSESNQPSPVSTPSSSRSMELNGFGSLRDQYLGTPGPMHYQY
LPHLFSYSAHPTLIPTQSRSLDPQSHTLINQLLTAEDIEPLSTPMLIEDGYKVTQSELFA
LLCRLADELLFRQITWVKKLPFFCDLSIKDYTCLLSTTWQELILLSSLTTYSKQIFGDLA
DVTSKYSPSEDELHRFSEDGMEVMERLIYLFRKFSQLKVSNEEYVCMKAINFLNQDIQGI
SSVSQVEQLNKRYWYVCQDFTEYRYPHQPNRFPDLMMCLPEVRYIAGKLVNVPLEQLPLL
FKAFLHSCKTSLTKE
Download sequence
Identical sequences A0A1B8YA22 Q66JK1
ENSXETP00000018759 gi|51703824|gb|AAH80883| gi|56118937|ref|NP_001008005| gi|82198466|sp|Q66JK1| gi|89268659|gb|CAJ83090| ENSXETP00000018759 NP_001008005.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]