SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000021769 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000021769
Domain Number 1 Region: 22-206
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-46
Family DNA gyrase/MutL, N-terminal domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 199-344
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.1e-25
Family DNA gyrase/MutL, second domain 0.00054
Further Details:      
 
Domain Number 3 Region: 557-632
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000236
Family HMG-box 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000021769   Gene: ENSXETG00000009885   Transcript: ENSXETT00000021769
Sequence length 928
Comment pep:known scaffold:JGI_4.2:GL172638.1:1724341:1805884:-1 gene:ENSXETG00000009885 transcript:ENSXETT00000021769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLRRLKMHCLPSATIRLLSSSQVITSVVSVVKELVENALDANATSIEIKLENFGFDKIE
VRDNGKGIKSDDTPVMGVKHYTSKINSHDDLETLETYGFRGEALASICSVAEVHIATKTL
EDDFSKLYILDSSGHVVSQKPSHLGQGTTVSVHKLFKNLPVRKQYYSTIKKCKEEIRNIQ
ELLMAYGIVTPNLRILFTNNKALVWQKSKTSDHKMAFMSVVGSAIMNCMVPIQYQSEDPK
IFINGYLPKPYADNTTTSLSSSEKSFLFINRRPIYHKEILKMVRWYHNQSLNKGTPRCYP
VFFMNIELPASCLDVNLTPDKTQIMLQNKEFVLHAVENVLRSVYPDSQILETHKDAMPED
TVTNNTDNSNTHLVGNKITRNDGELFSPCTVTNSIQEEKQSENSLEYQKLERDKIPYSDN
GEVAYSVSESTDGFLLNNESSTLQGKASADFGLQFAVRNSNLMDVQSNNTLDSVHQVLEK
DTWKTKTLTKVPDIGDDIWSKGSTFKDSLGDNLEPIKILNLSAETPFVKNTGEDSNIHNS
KNENTKPLNVISEKSGFVTAYDLISEKAIKKPLSAVGYFIQAERSKLIDDNPVASVEEIS
SKGKDLWGKLSQDKKSKYEEKAANNLERYNLQIAMATGEHIQKPKDIEKRHKLSSGPSPS
RKVKLKTPLCNQQILDKLFLSQEKKKNKPISSVQVAFKLSKLKQQISRLTDQQNSVKEEF
CFINKLSFPGAWIVASGSEIALLNPYRAEEALIFKQLLKNHKISAEKLDSPIVITDSLLG
GSQYLDALLSMQKDSPKPNGETYFSDPRLTANGFLIKIMPGKSPVENHIAIEGMASGLPF
YGVSDLKEILSFILINKSNKLCDCRPIKVWNYLEGEAVRLSRQLPINLSKEDVHDIMHRL
NNQCGSETKACLHGHLFFHHLADVPKTD
Download sequence
Identical sequences Q5FVX9
ENSXETP00000021769 gi|58476376|gb|AAH89718| ENSXETP00000021769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]