SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000024426 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000024426
Domain Number 1 Region: 4297-4455
Classification Level Classification E-value
Superfamily SET domain 4.19e-49
Family Histone lysine methyltransferases 0.0061
Further Details:      
 
Domain Number 2 Region: 753-814
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000642
Family PHD domain 0.0037
Further Details:      
 
Domain Number 3 Region: 166-218
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000443
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 827-896
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000221
Family PHD domain 0.036
Further Details:      
 
Domain Number 5 Region: 116-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000332
Family PHD domain 0.0082
Further Details:      
 
Domain Number 6 Region: 707-762
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000443
Family PHD domain 0.017
Further Details:      
 
Domain Number 7 Region: 1406-1456
Classification Level Classification E-value
Superfamily HMG-box 0.000014
Family HMG-box 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000024426
Domain Number - Region: 54-84
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0332
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000024426   Gene: ENSXETG00000011176   Transcript: ENSXETT00000024426
Sequence length 4455
Comment pep:known scaffold:JGI_4.2:GL172766.1:1873704:1928074:-1 gene:ENSXETG00000011176 transcript:ENSXETT00000024426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLIGFAEGVSSTQLFEPTGHCWAHHWCASWSAGVIHVEGTGLINVDKAVYSGISQKCEYC
NRMGATIQCHSTGCLRRYHFPCAAASGSFQSMKTLKLLCTEHLGEAIAMVFLFTLDDSRC
VLCDKPGDLIDLLFCTSCGLHYHGTCLEITVSPLKRSGWQCPECKVCQTCRQPGEDTMML
VCDACDKGYHTFCLKPAIECLPTDSWKCKTCRVCRICGSRTAHMEPGSQWYDNYSVCSKC
QEKRNRAETCVLCSHALPKEKCPNCIKYMRKTHCGCIAAQKLIVGKRRQNVYNCPMFVGM
SEMNLDPLQKKVSSETLMEPISDSMSLEEPIAYLIYSSSISLDIVTTEKSPPPLEAELPP
LNTMSDACDLLDEAPVLVTVEDEEMETEDTETEIHEVQKEVTGLALVSSSIKTASPTLVS
DTSQACASVIEGSDIRFTDTVHLTSGPCQSPSKTPSCSQQPSLSDSEMTIESEDPPCQPN
TEMLNNDNTFCQEHFGDYSVNKDQGPLRPGLIKSDIVNEISNLSQGDTTGSYHGSDALGS
PDPEGGSLSMEMCLHKEDGSLRLCNDSITETDDSLLYDPSGGKLDAEKTRRKSSPGRSRV
KQVSINTFSGLLTSTNGRFVFLSVSALYRSNTWGRSSSFPGRRRPRGGSGSGTSRGRGRS
RLKSTASSIETLPVVDVESSPSKEEEEEEDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFG
RGSEGHLLACSQCSQCYHPYCVNSRITKVMLLKGWRCVECIVCEVCGKATDPSRLLLCDD
CDISYHTYCLDPPLHTVPKGGWKCRWCVSCMQCGAVTPGFRSEWQNNYTHCAPCASLVSC
PVCHLKYLEGDLLIQCRHCERWLHAVCENLFTEEEVEQAADEGFDCSSCQPFIPKVNNPY
QSDSTSTTFFLPLAASSAEPQYFRFDGVWLTEAGMAVLRSLSLSPIQKKKPRRSRLCTGG
EVFIDGPDTVGTEERKEGEVEKSKYCNVEPMECDIKTEAMGSPEREACAETEPVKGMEDV
EDVKKKKRKPYRPGIGGFMIRQRKTHTRTKKGHAAFLEAFRESQNQDVHPDDAAPPETPT
ETGPETTITESDDKKKRRGRKKSKLEDMFPAYLQEAFFGKELIDLGKQALLASRPVSHKP
KPAQGATLPPQGSVQTSLQSTAEPVNAPTPAVPVEESDSSEMKAEKSEILFITVLSHELY
TITDYHSVGYVQNKNICLEQTNIYRNAHSHSEASLLSCMFLEYLGYKILTHGTNVLSVYM
AELPKMENTDIQQMLKDVLGPTDQEPTLNNIGGRMDSSTSGATSQSPQTFLQGKLYHLPS
FPFQINLYVFFIESFSQSGFLENSMSRNSVFSPEHCDSESSWPTASTPTTPTAEGEADGL
SYNQRSLQRWEKDEELGELSTISPVLYANKNFPNLKLEYPDWTSRCKQIMKLWRKVPAPD
KAPYLQKAKDNRAAHRISKVQRSILKLRDLLLPFALMIGVAWLSNELKNDSFSKIVFWTE
QQAENQINKQAKVEVARKIDRPVLQLQIPPHSGSQPGSTPDFRTGVPTAQDPFLSSGSVL
STSSDLFLKPSPAGTPGVESPGDVFFKLPPPSPSQEHMNSSPAYSLDPRYQSSLGQSPVS
CGSFQTMSGTENHPGPNAQQATHNLDYQSSHQATTHHQPLTPEPFIKPRYPAGSLDNLSL
IGSPGPRLSQSSENSSKPGEPMMSPSRYGDPKRHSDGMLYQVKNVGSADGTAEMKFDVFK
APLTPRTSQIEPHSPASSHRDPHLYAQVTSPQHHSDMYRQSSSSVSYTDPYSQPPLTPRP
QSSEGSCTLNPRSISSDSFTRVPTSPQSQASSQSPLTPRPLSAEAFCQSPVTPRFQSPDP
YSQPPSRPHSRDPFAPSHKPNRPQVTEQGFKPSSQLLHTSPVGSSYQSSQEVHPKVPVNQ
QQNSMFSRSPGASVFPNAQNQLCFTFPHSPGDSVKSSPSHQPNLPSSHSMNTFHPNKPQS
YASPNSNTPSFHAANSPHSSGNSSTSDVYAQSPHRPPSVLPQEQTFQSPSQRQGLNSPAE
KQREDLSGTANALGTTPKEGPELQSTPDPALSNMSQTELERHRQRQRLRELLIRQQMQRN
TLRQEKEAAAATLSSSHPGWSAELSGQSFDTVGRVIPASPGTSKPSAQSFPQDDRLNMPL
PNASPGTVDNSGRYGFPEGFRGTLLKSSNARGPFPDQAQVWQSPVASQRSVTPNRPSLTP
SLTSGGIVRFPFPGDQITSSSVTVGGAPYIELRHHAPKLPIGTTFSPPVSQTRPRFYLAS
EGGNPPLIPGVVRTDGNPIQMPVMRNPLLQVQKSLTSTPLTHHATHMVGVQQPLHAKVEA
IPEITQHQSNLQTPAPALSEGAKEGTSAGVEGGRVHCDDPPELDVDFDTHKDLEDDDLAN
LSLDVAKADDDLGNLDNLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLV
ESANEKAEEEALMKMEPDSSDAKTDCLPKKIQQEVSVNAIVETTKDKLTGDLGLELPHSG
GGKVAQIPSTAETKPAFSGNFKPKTEDGGMKSSNCQGARQSPSDDLDKMESSLVASELPL
LIEDLLEHEKKEQQKKLMSGPHAEGVPQHPMITHPTLSAQSGPHIQQHQDSHQANLVGLG
LVPRQAMNATSQLLSPQHQIQQRIAGAPLSTVMDSSLAGTPNQAHLLGGQHMVQTGISQT
QGLTPKPMIGQQIGVKPQQLVMQQQQQQLTNNIFPDTESDDIMDPIAKAKMVALKGIKKV
MAQGSIGVTPAMNRYNYIAVFVSSTKNSEADTVLPFYIQERCSMDTAQPRPNPPAFVQGV
INEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADA
EKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQHHNLVPQTLIGQIPPTSQAI
TGHPQSNLNANQKPDTPHSDSMEDMQQPNENLESVQSPFCVTSPVQQPVRQQHNLPLPPT
QQAVQNLGAESCRPHSGSASNSTIQPTPVPSGSSGDQTPLSGMFHVRQTPSSATEQAQQN
YAEENHQVNLQKSIPEHSTGTQVAGCGAVQSQESTTTQISQNISNFRHMGHQSQPQHKMP
QQQIQQLQQVEQHSSSHQGPQQPLQQSQQLQQTPPQIPQQLQLSQPQQLHVAQPQAKFNS
SSSCSRPISRPSSKPQLQQSPPVEHIQQLPNNMFNIRFNSYNNNTFSSLRIFSSIIKHMD
NFNITRMLKCNKDGPNPDSSSSIEASSASPMLSSVHESDAKPANTASFLPKEQPKESEPS
NDQSPATGDIHSDSQVEKPGQITESDAGKESNTKSLTNPNSHLENGEMADFPKFLKQEPI
ELGVSVQQDLKSEANCDNTSLGAKTEAGHLLLQKLLRAKTCQLATQRSADPLHSDINGHI
DNKLTVLEQKLKAASRNQEPENDIAAKKAVPKPKRTQKTNERVPNSRKKIRREDSIGALE
SIPDYYTQLLSKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTAAEDLSDAKKEAESSAET
EDKKESRYILLETVQIDYPLQLVLGTVERSLDLLAALPTPPHNQCEDVRMESDEESDVPD
SIVPASSPESVLGEETPRFPTLCEVKEEEEERALSPVIPLIPLCSIPDKRSRRKLFPVTP
ILYFATVFPDKSKGSEVSVMLTVSAAAAAAKSLNGVVAAVADLLSIKLPSSYEVLFPERG
LKSTVQVKKPEDPSTDGKQQVLRSIVYSIDWLHMAIQVSGSFVNSSFLGEKERSQLGKAE
NSTDWLKQLDAVLPGYTLKNELDILTLLTQEENAVENSAHHCYMNNVSNLDVRQLPVLPE
VSSPPPSPFVPSPATPGEPSAEPDPHKEDCKDMAKIKQRARPPEDGIEEPKPRIKKWKGV
RWKRLHILITFQKIVSRHCEKEICEVIERLGTTLRPETLPPDLRKCCFCHEEGDGPTDGP
GRLLNLDLDLWVHLNCALWSTEVYETQGGALINVEVALHRGLLTKCSLCQKTGATNSCNR
LRCPNVYHFACAIRAKCMFFKDKTMLCPMHKLKGPCEQELSCFTVFRRVYIERDEISQIA
SIIQRGDRIHMFRVGGLVFHAIGQLLPHQMQDFHSVTALYPVGYESTRIYWSMRHSHRRC
CYRCRVCDNNGRPEFTVQVIEYGYEDVILTDSSPQALWNRVAEPVARMRRETGMLRLFPE
YLKGEEMFGLTVHAVLRIAESLPGVENCQNYLFRYGKHPLMELPLMINPTGCARSEPKIM
THYKRWVIRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLKTEWKTNVYLA
RSRIQGLGLYASKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVID
ATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHK
IPCHCGAWNCRKWMN
Download sequence
Identical sequences F6YTM2
ENSXETP00000024426 ENSXETP00000024426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]