SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000025230 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000025230
Domain Number 1 Region: 353-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-19
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 292-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 401-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000031
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000025230
Domain Number - Region: 223-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.044
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 24-68
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0993
Family Gonadodropin/Follitropin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000025230   Gene: ENSXETG00000011532   Transcript: ENSXETT00000025230
Sequence length 519
Comment pep:known scaffold:JGI_4.2:GL173463.1:268392:278774:1 gene:ENSXETG00000011532 transcript:ENSXETT00000025230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESHFNSSYFWPAVPTVSGQQIDNSMFLNKVKEQLIQEKGCNLSSHYPTLLTVPTSMSL
PAGISMDTDSKVELHGIQHSQASVTQNITVLPVPTTGLMTASKLCRHLFGFSHCIQSHLP
AGLVITSPSGSLVTTPSSSNVFLLTSAHIIFCLLPKCMAQCAPSCSCWQANSVGEKGGGG
GVVHSVAMLGKGECVLAVQSWGRDGDERVECSGRKRDEHVKVGKEWVTCLLLSMAHTHAE
QRRIHLKVHGAVSKPHKCPHCSKTFANSSYLYQHVRIHSGVKPYNCSYCQKAFRQLSHLQ
QHSRIHTKVHSIVSKPYKCPHCSKTFANSSYLHQHLRIHSGAKPYNCNYCQKAFRQLSHL
QQHTRIHTGDRPYKCVHPGCDKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDASALEV
HLSTHTVKHAKVYTCSICSRAYTSETYLMKHMRKHNAPEPQQPPPTQVLTSQAHFTPVSQ
ASDGPQCSFDMNPFKTDHHKDLCLTVATSTIQVEHLASS
Download sequence
Identical sequences F7EMC0
ENSXETP00000025230 ENSXETP00000025230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]