SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000025396 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000025396
Domain Number 1 Region: 282-381
Classification Level Classification E-value
Superfamily HMG-box 4.58e-24
Family HMG-box 0.00000265
Further Details:      
 
Domain Number 2 Region: 523-619
Classification Level Classification E-value
Superfamily HMG-box 2.09e-20
Family HMG-box 0.0000176
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 5.11e-20
Family HMG-box 0.00000517
Further Details:      
 
Domain Number 4 Region: 194-273
Classification Level Classification E-value
Superfamily HMG-box 1.7e-18
Family HMG-box 0.00087
Further Details:      
 
Domain Number 5 Region: 450-522
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000602
Family HMG-box 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000025396   Gene: ENSXETG00000003356   Transcript: ENSXETT00000025396
Sequence length 668
Comment pep:known scaffold:JGI_4.2:GL172791.1:747539:758307:1 gene:ENSXETG00000003356 transcript:ENSXETT00000025396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAAGGVAKGNMTAPKDQDQWSQEDMLTLLQTMKSLLPSQDNSKFKTTESHLDWNKLAF
KNYSGSMCRQKWMEISNEVRKFRTLTELILDAEEHVKNPYKGKKLKKHPEFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQKEKLDFERNLAKFR
DEHPDLMQNPKKSDVPEKPKTPQQLWYNHERKIYLKLHADASTKDVKEALGKQWSQLSDK
KRLKWIHKALEQRKLYENIMREYMQKHPELNLTEEGITRSTLTKAERQLKDKFDGRPTKP
PPNSYSMYCAELMANMKDVPSTERMVLCSQRWKLLSQKEKDAYHKKCEQKKKEYEVELMR
FLENLPEEEQQRVLAEEKMVGIRKGTNTPASKMATQDAAKGSSMFHGSDPQRSDHSAVAW
ICYCSVCMAAQVKSRSSQADKKKAADERAKLPETPKTAEEIWQQSVIGDYLARFKNDRAK
ALKCMEATWLNMEKKEKIMWIKKAAEDQKRYERELSDMRSAPTPTTAGKKVKFLGEPKKA
PMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWHRISPAQKEYYKKLAEDQQRIYRTQF
DAWMKTLSSQDRAAYKEQNSNKRKSTTKIQTPSNKSKLVVQSKSSSEDGDSSESSTDEDS
EDGEEESN
Download sequence
Identical sequences F7DIJ6
ENSXETP00000025396 ENSXETP00000025396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]