SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000025499 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000025499
Domain Number 1 Region: 630-825
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000373
Further Details:      
 
Domain Number 2 Region: 443-556
Classification Level Classification E-value
Superfamily PH domain-like 3.79e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 10-94
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000557
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 243-284
Classification Level Classification E-value
Superfamily WW domain 0.00000000314
Family WW domain 0.0027
Further Details:      
 
Domain Number 5 Region: 349-378
Classification Level Classification E-value
Superfamily WW domain 0.0000117
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000025499   Gene: ENSXETG00000011657   Transcript: ENSXETT00000025499
Sequence length 827
Comment pep:known scaffold:JGI_4.2:GL173139.1:642757:678369:1 gene:ENSXETG00000011657 transcript:ENSXETT00000025499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEMADKSGKPVPGPVYIEVEYDYEYEYKNKKIVIKQGEKYILMKKSNEDWWQVKKDENAK
PLYVPAQYVKEVGRKALMPPVKQQTLLPNSPLKVAHRSTENINKSPELSSFGKTSSFRDA
NQNMGPSSSPGPTRALTLDLVHNNGKLNCDLHSPKGTSRSPSATHFPGPELMEVEKASLS
NEHSGDSAGDSSEKILLDSESGDELSSSSTEQLQFSISPAPPRSDSPVYANLQELKISQS
ALPPQPMSPPVLVTGEWETHKDNSGRYFYFNKATQERTWKPPRGAKEAGPGKSESFSQAD
HEQLSADDIYHSTCDNQSDSQYGSPPRGWSEELDQHGHTTFINDQTNEKWIKHVDDQGRP
YYYSADGSRSEWELPKYNATLQPLREITKSRSLDRKLQDPIVFTKWRHSTILLDTNDKDS
SATSKPDETSPPSPKQQVTDQEKYGVLLVTKITENGKKVRKNWMSSWTVLKGTTLLLQAN
AAGWKFGGNQSKPEFTVDIKGASVDWASKDKSSKKNVIELKTTSGTELLIQSDSDTVIKD
WYTAFCNTTGTTPGDLEEACEDNVPESPVDKHGKEKFDKEKDHDRDSKKNRSFKPANSID
NAEQKKTKTKLKKFLTRRPTMQAVREKGYIKDPVFGSSLASLCQRENTTVPNFVKMCIEH
VEEQGLDVDGLYRVSGNLAVIQKLRFAVTHDEKLDLNDSKWEDIHVITGALKMFFRELPE
PLFTFSHFNDFVNAIKQEPKLRVQAIKDLIKQLPKPNHDTMQALFKHLKKVVETGEKNRM
TYQSLAIVFGPTLLKPESETGNIAIHTVYQNQIVELILLECNSIFGR
Download sequence
Identical sequences F7ERM2
ENSXETP00000025499 ENSXETP00000025499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]