SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000025587 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000025587
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 6.24e-54
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 432-501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00004
Family Fibronectin type III 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000025587
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily L domain-like 0.00051
Family Ngr ectodomain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000025587   Gene: ENSXETG00000011704   Transcript: ENSXETT00000025587
Sequence length 666
Comment pep:known scaffold:JGI_4.2:GL172685.1:585517:587517:1 gene:ENSXETG00000011704 transcript:ENSXETT00000025587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGTVIWPKNWVSFLKSWLVFSFGLSIQLSQSVACPSVCRCDRNFIYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVDTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRVALAQLTKLEELHLDDNSISTVGVEDGAFREAISLKMLFLSKNHLSSVPVGLPL
CLQELRLDENRIATISDQAFQNLTNLERLILDGNLLTNKGITDGTFSHLPKLKEFSMVRN
SLTTPPTDLQGTYLVKLNLQDNQINHIPVSAFASLHKLERLDISNNRLKMLTKGVFDNLT
NLKQLTARNNPWYCDCSIRWVTEWLKSLPAAINVRAFMCQGPEHFRGMAVRELNVNLLSC
PTTTPILPPVTSASPTIAPTTPLSTVFIVTPTEAPTEPTPTPSLPPISPTLPDQVIIVDK
VTPLHQDRLQIVIHYVNNTCVNVKWISFISVISFKLTWVKMGHSLVEGIVHERIVSSDRL
HFTLVNLEPKSTYRICLVPLDAFNNYQAGEETVCAEAITKASLLNNGSNSPSSHEQTTPQ
GMGSPFLLAGLIGGAVIIVLVLLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKK
DNSILEMTETSFQIVSLNNDQLLKGGFRLQPIYAPNGGISYTDCHIPNNLRYCNNSSVPD
LEHCHT
Download sequence
Identical sequences F7DTK8
ENSXETP00000025587 ENSXETP00000025587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]