SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000027035 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000027035
Domain Number 1 Region: 306-538
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-68
Family Nuclear receptor ligand-binding domain 0.00000000257
Further Details:      
 
Domain Number 2 Region: 176-258
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-29
Family Nuclear receptor 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000027035   Gene: ENSXETG00000012364   Transcript: ENSXETT00000027035
Sequence length 585
Comment pep:known scaffold:JGI_4.2:GL172842.1:470966:546032:1 gene:ENSXETG00000012364 transcript:ENSXETT00000027035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMPLHNKTTGVTLLHQIQSSELETLSRPPLKIPLERPLSEMYVENNRTGIFNYPEGTTY
DFAAAAAPVYSSASLSYAASSETFGSSSLTGLHTLNNVPPSPVVFLQTPQLSPFIHHHGQ
QVPYYLESEQGTFAVREAAPPTFYRSSSDNRRQSGRERMTSANDKGPPSMESTKETRYCA
VCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCY
EVGMMKGGIRKDRRGGRMLKHKRQKEEQEQKNDVTPSEIRTTSIWVNPSVKSMKLSPVLS
LTAEQLISALMEAEPPIVYSEHDSTKPLSEASMMTLLTNLADKELVHMINWAKRVPGFVD
LTLHDQVHLLECAWLEILMVGLIWRSVEHPGKLSFAPNLLLDRNQGRCVEGLVEIFDMLV
TTATRFRMMRLRGEEFICLKSIILLNSGVYTFLSSTLESLEDTDLIHIILDKIIDTLVHF
MAKSGLSLQQQQRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRM
HTPKDKATAQEEDSRSPLTTTANGASPCLQPFYTSTEEVSLQSTV
Download sequence
Identical sequences Q25C14
gi|89331174|gb|BAE81788| ENSXETP00000027035 ENSXETP00000027035 8364.ENSXETP00000027035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]