SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000029233 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000029233
Domain Number 1 Region: 328-713
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.23e-127
Family Oxysterol-binding protein 0.0000318
Further Details:      
 
Domain Number 2 Region: 74-194
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-24
Family Pleckstrin-homology domain (PH domain) 0.000000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000029233   Gene: ENSXETG00000013334   Transcript: ENSXETT00000029233
Sequence length 820
Comment pep:known scaffold:JGI_4.2:GL173177.1:744656:775557:-1 gene:ENSXETG00000013334 transcript:ENSXETT00000029233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFDKGKDEVLQSKEDTSISMSKSKSESKLYNGSERDIASASSKLTKKESLKVQKKNYREE
KKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTPKNGQWVGTV
LLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRAASES
DGRCWMDALELALKCSSLLKRTMIREGKEHDLNSSADNSHVGFYGLLRVNNLHSNENFQL
NDSEIERHHFKDQDTYSDKSDKDNDHDHDESDNDGLGKSEESDSDTSERQDDSFVDPDPP
ELIKETTYVEEAHEELGEAGEASQTETVSEEHKSLIWTLLKQVRPGMDLSKVVLPTFILE
PRSFLDKLSDYYYHADFLSEAALEENPYSRMKKVVKWYLSGFYKKPKGLKKPYNPILGET
FRCLWIHPRTSSKTFYISEQVSHHPPVSAFYVSNRKDGFCLSGSILAKSKFYGNSLSALL
EGEGRLTFLNRGEDYLMTMPYAHCKGILYGTMTLELGGSVTITCEKTSYSATLDFKLKPF
LGSDDSVNQISGKIKLGKEVLATLEGHWDSEVFIHDKKTDVFETFWNPTLEIRHHRLIRC
TVNQEEQGEFESERLWRLVTLAINNKDQTEATQEKFVLEEAQRKAAKERKAKGEEWTCKL
FEQDPLTGEWHYKYADTRPWDPLNDLIQFENDGVIQTKVRHRTPMVCVPKLKHKASGQQK
KGESGCSSPELDNQDSSGSEAHLLSHNNRVRKKGADHGELQSAIDSIKKTQEEINRNIIA
LRNRVSVNTSSTENSFLQQRDYFIIFFLITLQIAVSYLFK
Download sequence
Identical sequences F7A3Q9
ENSXETP00000029233 ENSXETP00000029233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]