SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000029670 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000029670
Domain Number 1 Region: 367-458
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.26e-39
Family Small-conductance potassium channel 0.00000342
Further Details:      
 
Domain Number 2 Region: 236-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000029670   Gene: ENSXETG00000013542   Transcript: ENSXETT00000029670
Sequence length 550
Comment pep:known scaffold:JGI_4.2:GL172730.1:653300:711550:-1 gene:ENSXETG00000013542 transcript:ENSXETT00000029670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESNNFLDIAMNSCRYNGGIPRPLSSLSSSRRNLHEQDPETQPLQTLHSPGVEVVVSKND
PSKASHRSLRGVEEGSQEAPRGQKKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIA
MTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANADIDIILSIPMFLRLYL
IGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKV
RKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRII
TLETKIDSLNTSLQSLPGLIAHALLREQGELFLLRSHRPFPPSNSSDNSWSPPRRRTSPS
TAPHTSSDSG
Download sequence
Identical sequences F6SM41
ENSXETP00000029670 ENSXETP00000029670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]