SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000029677 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000029677
Domain Number 1 Region: 156-207
Classification Level Classification E-value
Superfamily HMG-box 0.0000524
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000029677   Gene: ENSXETG00000013543   Transcript: ENSXETT00000029677
Sequence length 220
Comment pep:known scaffold:JGI_4.2:GL172730.1:759065:784381:-1 gene:ENSXETG00000013543 transcript:ENSXETT00000029677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKKFQGENTKSAVARARKAEAKAVADAKRQKEIEDAYWQDDDKHVMRKGQRKEDKEKKR
LEQLERKKESQRLLEEEDSKMKGKPIKPAAPSKVTRAQIEETLHREEEEKGEPDAIEKPK
THLEIPLEENLNRRILEEGEVEARTVEDAIAALSMSKELDRHPERRMKAAFTAFEEINMP
RIKQENPNMRLSQLKQLLKKEWMKSPENPMNQQHATYNAQ
Download sequence
Identical sequences G1K3G0
ENSXETP00000029677 ENSXETP00000029677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]