SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000030968 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000030968
Domain Number 1 Region: 210-290
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-26
Family PHD domain 0.00046
Further Details:      
 
Domain Number 2 Region: 351-682
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.31e-24
Family Hect, E3 ligase catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000030968   Gene: ENSXETG00000014180   Transcript: ENSXETT00000030968
Sequence length 690
Comment pep:known scaffold:JGI_4.2:GL172673.1:1318491:1329207:-1 gene:ENSXETG00000014180 transcript:ENSXETT00000030968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRIRRKSSKNLPCVFCGLSDDCAEKFGEKKTYPEHDLTLHYYCLLLSSGIWQRGKENEG
IYGFLVCDIKKEVNRANKLRCALCKNRGASIGCVFPKCRRSYHYHCGVKKECIFQFTDSF
RSYCWEHRPVQKIVSSQTDCSSTCTICLENVNHVSSYHILRSPCCKTSWFHRNCLQHQAL
SAGLFFFRCTVCNNKDIFQNEMLRMGIHIPERDASWELEENAFQELLVRYQRCDAKKCVC
RGGREYNEPENKWEIVRCQCCGSSGTHRACSSIGELDQSWECPDCCSVVSTPGKRSRPAS
LAQSDQLGCLGFGMESSPKCPRLSTTPKGKVLLRHISTQERTISDILHNLRLQINTDSVC
TMLIQKECLWQSSLECFRNSNFCPSSTLRVKFTKHKFRMECKQPNGSLSEYFGLLLNTVR
NSPLLEGSEHKNIALNLEALEDNLYFEAGRMVALALVHGGPAPGFFSQTLFRCLIYDPQH
VLPAVEDVADPNVAQAILTIQSCQRIGTLKSAIIHYFDYLQKTGSLRLVQTVSDKVLIIK
ELLAHHVIRRVQQPLESFKQGLMTLGVLEKIQAHPAIFWSVLVLGPEKLTAKSMTDLFTV
THTDLGVKQQSDALGFWVDYLEDTEEGTTVCSLEDILNFATGLPSVPPAGFDPRPSIRFK
QMAQPKARKYINCLELPSFSSYLDFTRSMN
Download sequence
Identical sequences F6PX02
8364.ENSXETP00000030968 ENSXETP00000030968 ENSXETP00000030968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]