SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000032292 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000032292
Domain Number 1 Region: 1115-1310
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 901-1024
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-29
Family Pleckstrin-homology domain (PH domain) 0.00000935
Further Details:      
 
Domain Number 3 Region: 15-43,71-143
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000032292   Gene: ENSXETG00000005905   Transcript: ENSXETT00000032292
Sequence length 1915
Comment pep:known scaffold:JGI_4.2:GL172683.1:1726710:1781122:1 gene:ENSXETG00000005905 transcript:ENSXETT00000032292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISKNKDGQEQSEMVSPTEEEGFCWPGPKSVALRRASEGFGFTLRHFIVYPPESAVHTTVK
DEENGNRGGKKGRPETGWEPMDTIFVKQVKEGGPAHEAGLCTGDRIIKVNGESVIGKTYS
QVIALIQNSDSTLELSVMPKDEDILQLAYSQDAYLKGNDSYSGNAQNIPEPPPICYPRTK
PAASVMAQPVEVPPSGTSLTKQQSSRPVRTATTQPDRSYRVEIQVPPSPTDIVKSNTAVC
VCNEAVRTVILPSEKVVDLSSNRTNRAGPLHRTEEVRYGLADPSMLKRTTSPPSSTPSVP
MVPASRQFDNAGVIGKPPSYGGHSESMFSTRPSQAEESPSPTNHYASPGSHQQIDWRNYK
TYKEYIDNRRMQMYGCRTIQERLDSLRAASQNTTDYDQMLPNRSSGQVRRRSTSHDRVPQ
SVQMRQRSVSQERLEDPVLMKEWPRSASQDTLTSLTVAPRNHRSESWDYLTRKEDFDQFI
VDTQSNGEQKHNYKWTGFTEQDDQRGIYEIPRQHSFHMSLRSPNYTMAPLPYPSDSRRAG
TRVLAPARPLQKVHPDLKTIQPTRNFQNSYRSPHPRPAVSERLVFPISKSNSVKIPATYA
SKPYSPSVGSEDGIVKDQKAVNYIHVSGPQNFQRKPQTESALGFQLDSLKTSTSASSSSP
AHTKPAKQVKHSTATSQNVDGKKTQSPEANASDSNSVLTSIDQVVLREKPSPGQQTSQPI
RQPSYIFAVSDVEGASDTTCWLPNDARREVHIKRIEQKKASGSDSPGDSLASIPFIDEPT
SPSIDHEIANIPASAVISISVQPLPTITTVPPSPTSPVPLIRRHFSHDHDSIRPSILEVN
SKTERSKSCDEGLDDYKDEGKLSLKQGSSLKGIKARENVPSSEDSESRKDSSSDVFSDSN
KEGFLYFRQLTTEKGKRVSGSMRPWKQMYVVLRGSALYLQKDKKEQSGHSSAQSDEEQLI
GINGCLIDISYSETKRKNVFRLTTSDREFLFQAEDRDDMLAWIKAIQENGNLNDEQTDQA
SRVLISKRIKEYNTMMSSSSNKSEQSPKPSRQTLSIRQPFRATKPEGKLQSPHSPKQESE
RRLFSKDDISPPKDKGSWRRIMKKPFEKKPTTGGTFGVRLDDCPPAHNNKYVPLIVDVCC
KLVEDRGLETTGIYRVPGNNAAISSMQEELNKGSTDIDIQDDKWRDLNVISSLLKSFFRK
LPDPLFTNEKYNDFIEANRTEDPVERLKTLKRLILDLPDHHYETLKYLSAHLKAVAENSE
KNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQQHDWFFSEESADEPIT
AVQEESTVESQPVPNIDHLLPNIGRTGLSPGDVSVMSLVDSMIQRGSWGSGKDQYSRELL
VSSLFAAASRKRKKQRDKPQPSSSEDELDNVFYQKELLQVEFQRPDKQNVDKDVDLKANA
LSLKDADNIKGTNIIKEDKLEKDIMHSEATSPCPPKLSEPPIVNHRLPPDDKNIPQISFQ
MEESMSDSGTMLSTSSQASAQRSKPKVVSPELKGSDFLTADVSSITSDYSTTSSTIYITG
LDQNLISPEVQSVAESKGEEADDERSELISEGRPMETDSENDFPIFASSIAFDRQHRSKV
EEPTRNVQVNSEGSPSCTEGSITPRMDRRRFSSHKLIECDTLSRKKSIRQKTDSECSAES
KNEETLSDAQEAVKKGRSLSIGDTTTNNEPEEPAWRIKITERLKLRLKASADDMFGIGSQ
KAQAAETRKKKNIRRRHTLGGQRDFAEISVLNAWKINEPSSKEAELSAVDRLKPKCPSQD
LSISDWLARERLRTSTSELSMVEPEEKRISDATSQKEPASPSPPPPASSPSQVSTAIVTA
GSESPSQGTAPPPDDQMNGDSFQSKNKNNFSPAVDAHPHKLSGTQVVRSRFYQYL
Download sequence
Identical sequences F7DPY0
ENSXETP00000032292 ENSXETP00000032292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]