SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000032333 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000032333
Domain Number 1 Region: 52-194
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000615
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000032333   Gene: ENSXETG00000014759   Transcript: ENSXETT00000032333
Sequence length 217
Comment pep:known scaffold:JGI_4.2:GL172691.1:623542:634734:1 gene:ENSXETG00000014759 transcript:ENSXETT00000032333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRQRAQDRTQHFQTMIKSKLNVLTLHKEPLPAVIFHEPEDIELCTTMPLMKTRPHAGCKV
TYLGKVSTTGGQFASGCTEQPVIELWKQHTLAREDVFPSNALLEIRPFQVRLHHQDLKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSFQMDCHAVECESKLEAKKLAH
AMMVAFKKTFQSMRSDGRIHQDSSSEEVSQGFESDDG
Download sequence
Identical sequences F7CNF3
ENSXETP00000032333 ENSXETP00000032333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]