SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000033068 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000033068
Domain Number 1 Region: 128-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 187-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.13e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 244-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 80-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-18
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000033068   Gene: ENSXETG00000024263   Transcript: ENSXETT00000033068
Sequence length 352
Comment pep:known scaffold:JGI_4.2:GL174052.1:27310:37068:-1 gene:ENSXETG00000024263 transcript:ENSXETT00000033068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQENPQSGAASGLPYTQDLAKDQSHPENQMLIHKSINTDSLENLGTDSEEKNFSQNNSF
AVNEKGLKPFPCTESAKDPSHQQLLTGDKPFTCTECGKEFSQKSHLHSHQKIHTGEKPFS
CTECGKEFSHRSSLHSHQKVHTGEKPFSCTECGKEFSDSSSLHRHQKIHTGEKPFQCTEC
GKKISDRSSFHRHLKIHTGEKPFSCTECGKEFSDSSNLHSHHKIHTGEKPFSCTECGKEF
SYKTLHSHQKIHTGEKSFSCTECGKIFSHRSNLHSHQRIHTGEKPFSCTECGKEFSQKQP
SLTPENPHRGETFLLYRMWERILSINPPSLTPENPHRGETFLLYRMWERICL
Download sequence
Identical sequences K9J881
ENSXETP00000033068 ENSXETP00000033068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]