SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000033399 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000033399
Domain Number 1 Region: 87-170
Classification Level Classification E-value
Superfamily HMG-box 1.44e-25
Family HMG-box 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000033399
Domain Number - Region: 231-323
Classification Level Classification E-value
Superfamily Tropomyosin 0.000719
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000033399   Gene: ENSXETG00000015269   Transcript: ENSXETT00000033399
Sequence length 345
Comment pep:known scaffold:JGI_4.2:GL172931.1:191297:203870:1 gene:ENSXETG00000015269 transcript:ENSXETT00000033399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENTASAAPPSSEDLVVDTKENAEPPFCGISLSGSSQAPFHPQSPTLQQDERDELILQQS
GEQQLGNSGELRQEEELPKTRRGGWTKGRKRKRSPRDNNAPKAPLTGYVRFMNERREQLR
TERPDVPFPEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQQYQNTDAYQTYSRK
AQSRQKGRQQRQEGVRGVPINTEKESILKERPIFDIPIFTEEFLNHSKAREAELRQLRKS
NMEFEERNAALQKHVESMRSAVQRLEAELNQEQERNSLLQQHLQSVRQALTHCLQSVPIP
GTTEIPTLETIDLYMSRLQNAVLTHPKESEVIISGVREVLSQLEG
Download sequence
Identical sequences Q6DIJ5
ENSXETP00000033399 gi|49523172|gb|AAH75543| gi|55742128|ref|NP_001006760| gi|82183397|sp|Q6DIJ5| 8364.ENSXETP00000033399 ENSXETP00000033399 NP_001006760.1.99540 XP_012821857.1.99540 XP_012821859.1.99540 XP_012821860.1.99540 XP_012821861.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]