SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000033589 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000033589
Domain Number 1 Region: 34-277
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-71
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000033589   Gene: ENSXETG00000015374   Transcript: ENSXETT00000033589
Sequence length 278
Comment pep:known scaffold:JGI_4.2:GL172700.1:2706762:2709950:-1 gene:ENSXETG00000015374 transcript:ENSXETT00000033589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLDKCHCAVDNRKHGSILYNILKNEEHKESHNSNPRKGNHTGVYGQGCSCGAQKKVSL
KSPQVTCKAASAVLVKTLRFVKNVPCFQELPLDDQMLLVRSCWAPLLVLGLAQDKVDFET
VETSEPSMLQRILTTRQDGEKKQSQQDSLLGSPQHKLSQLPSAAEIRWIKEFLDKCWNLD
ISTKEYAYLKGIVLFNPELPGLHCIQYIQGLQHEAQQALNEHVKMIHRWEQTRFTKLIIV
LSFLRTVNANAIAELFFRPIIGSVNMDDMLLEMLGAKI
Download sequence
Identical sequences F6ZB97
ENSXETP00000033589 gi|301608183|gb|XP_002933661| ENSXETP00000033589 8364.ENSXETP00000033589 XP_002933661.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]