SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000034677 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000034677
Domain Number 1 Region: 431-716
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-80
Family Kelch motif 0.000000917
Further Details:      
 
Domain Number 2 Region: 161-278
Classification Level Classification E-value
Superfamily POZ domain 9.03e-34
Family BTB/POZ domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000034677   Gene: ENSXETG00000015861   Transcript: ENSXETT00000034677
Sequence length 724
Comment pep:known scaffold:JGI_4.2:GL172828.1:1423533:1495272:-1 gene:ENSXETG00000015861 transcript:ENSXETT00000034677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSGKKEFDVKQILRLRWRWFSHPSQGSAGSGGCLQQEGYEHRGTPVHNRLKSHSRDRN
GLKKNSSPVHNILAPVPGPTPAYNRSIQSWQQQNIIENFQASEDIPKPGTEEKLAKEEES
KGAEEVQAIPEEHPEAATDRLHVTCSSPNRMNASGSDEYFQSLNHAEQTFRKMENYLQQK
QLCDVLLIAGNLKIPAHRLVLSAVSDYFAAMFTNDVREAKEEEIKIEGVDPDALKALVHY
AYTGVLELKEDTIESLLAAACLLQLSQVIDVCCNFLMKQLHPSNCLGIRSFGDAQGCVEL
LRVAHSYTMEHFIEVIRNQEFLLLPASEIAKLLSSDDINVPDEETIFQALMQWVKHDIQC
RQRDLGMLLSYIRLPLLPPQLLADLENSPMFANDLECQKFLMEAMKYHLLPERRSMMQSP
RTKPRKSTVGALYAVGGMDATKGATTIEKYDLRTNSWIQISTMNGRRLQFGVAVIDNKLY
VVGGRDGLKTSNTVECFNPVTKVWSIMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNT
VERWDPQARQWNYVASMSTPRSTVGVAALNSKLYAVGGRDGSSCLKSMECFDPHTNKWSM
CSPMSKRRGGVGVATYNGFLYAVGGHDAPASNHCSRLSDCVERFLYTRYDPKTDNWTMVA
PLSIPRDAVGVSPLGDRLYAVGGYDGQSYLNIVESYDAQTNEWTQDVSLNIGRAGACLEV
IKLP
Download sequence
Identical sequences F6YBS4
ENSXETP00000034677 ENSXETP00000034677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]